UniGene Name: sp_v3.0_unigene81385
Length: 211 nt
![]() |
---|
>sp_v3.0_unigene81385
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 40S ribosomal protein S2/30S [Ornithodoros parkeri] | - | - | 2.0e-24 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
Sma3 | 40S ribosomal protein S2 | - | - | 1.709e-19 | - |
Source | Gene names |
---|---|
Sma3 | At1g58380; At1g58684; At1g58983; At1g59359; At1g59359 orthologue; At2g41840; At3g57490; CHLREDRAFT_195602; F19C14.1; F9K23.9; GSVIVT00025575001; LOC_Os03g59310; MICPUCDRAFT_49763; MICPUN_90856; OJ1119_B04.29; OSJNBa0059E14.8; OSTLU_18532; Os03g0807800; Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | small ribosomal subunit | GO:0015935 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S5 | IPR000851 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, C-terminal | IPR005324 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, eukaryotic/archaeal | IPR005711 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, N-terminal | IPR013810 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, N-terminal, conserved site | IPR018192 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G58684.1 | Ribosomal protein S5 family protein chr1:21770021-21771217 REVERSE LENGTH=284 | 2.0e-31 | 74% |
RefSeq | Arabidopsis thaliana | NP_564740.1 | 40S ribosomal protein S2-2 [Arabidopsis thaliana] | 3.0e-31 | 74% |
RefSeq | Populus trichocarpa | XP_002308954.1 | predicted protein [Populus trichocarpa] | 4.0e-29 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMF2
Fln msg: Distance to subject end: 128 aas, your sequence is shorter than subject: 70 - 270
Fln protein:
V
Protein Length:
71
Fln nts:
G
Fln Alignment:
GDTE5QK01ECQF5___VEHFLGESLKDEVMKIMPVQKQSAAGQRTRFKAFIIVGDKNGHCGLGVKCGKEVALAIRGAIVAAKLAVI
A9NMF2_______________VEAMLGPQLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain