|
||||||
|
UniGene Name: sp_v3.0_unigene81276
Length: 217 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81276
G |
|
Ace file of the UniGene sp_v3.0_unigene81276 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CBL-interacting serine/threonine-protein kinase 5 n=2 Tax=Arabidopsis RepID=CIPK5_ARATH | - | - | 1.0e-30 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
| Sma3 | CBL-interacting serine/threonine-protein kinase, putative | - | - | 2.869e-31 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 0.0 | - |
| Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 1.435e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | ACRE216; ATPK10; At1g01140; At1g29230; At1g30270; At2g26980; At2g30360; At2g38490; At3g23000; At4g14580; At4g18700; At4g30960; At5g01810; At5g01820; At5g07070; At5g10930; At5g21326; At5g25110; At5g45810; At5g45820; At5g58380; B1131G08.36; CIPK; CIPK1; CIP |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | potassium channel activity | GO:0005267 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | response to nutrient | GO:0007584 | Biological Process | 0.0 | - |
| Sma3 | response to pH | GO:0009268 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
| Sma3 | potassium ion import | GO:0010107 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Ribosomal protein S14, conserved site | IPR018271 | - | 0.0 | - |
| Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G10930.1 | CIPK5, SnRK3.24 CBL-interacting protein kinase 5 chr5:3445569-3446906 REVERSE LENGTH=445 | 3.0e-39 | 84% |
| RefSeq | Arabidopsis thaliana | NP_568241.2 | CBL-interacting serine/threonine-protein kinase 5 [Arabidopsis thaliana] | 4.0e-39 | 84% |
| RefSeq | Populus trichocarpa | XP_002317414.1 | predicted protein [Populus trichocarpa] | 7.0e-39 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWA3
Fln msg: Distance to subject end: 221 aas, your sequence is shorter than subject: 72 - 426
Fln protein:
D
Protein Length:
73
Fln nts:
G
Fln Alignment:
GDTE5QK01D6Y8E___DLKPENLLLDENGDMKVTDFGLSALPEQFRQDGLLHTACGTPAYVSPEVITKKGYDGAKADIWSCGVILFVL
A9NWA3_______________DLKPENLLLDENGDMKVSDFGLSALPEQFRQDGLLHTACGTPAYVSPEVITKKGYDGAKADIWSCGVILFVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
