UniGene Name: sp_v3.0_unigene81099
Length: 135 nt
![]() |
---|
>sp_v3.0_unigene81099
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Heat shock cognate 70 kDa protein/HSC70/HSP70 n=1 Tax=Arabidopsis thaliana RepID=Q9C7X7_ARATH | - | - | 9.0e-15 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Heat shock protein 70 | - | - | 8.879e-28 | - |
Source | Gene names |
---|---|
Sma3 | At1g16030; At1g56410; At3g09440; At3g12580; At5g02490; At5g02500; At5g28540; At5g42020; BIP; BIP1; BIP2; BIP4; BIP5; BIPE2; BIPE3; BLP4; BiP; BiPD; Bip; CHLREDRAFT_133650; CHLREDRAFT_133859; CHLREDRAFT_185673; F11F8; F13N6.9; F3L24.33; F7G19.5; GSVIVT0000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleomorph | GO:0033009 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56410.1 | ERD2, HSP70T-1 heat shock protein 70 (Hsp 70) family protein chr1:21117147-21119241 FORWARD LENGTH=617 | 4.0e-20 | 86% |
RefSeq | Arabidopsis thaliana | NP_001119156.1 | heat shock 70kDa protein 1/8 [Arabidopsis thaliana] | 4.0e-20 | 86% |
RefSeq | Populus trichocarpa | XP_002336881.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-22 | 86% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LRY5
Fln msg: Distance to subject end: 600 aas, atg_distance in limit (1-15): atg_distance = 9, W2: There is no M at the beginning, your sequence is shorter than subject: 44 - 652
Fln protein:
I
Protein Length:
45
Fln nts:
C
Fln Alignment:
GDTE5QK01CC5ET___IGIDLGTTYSCVAVWQHDRIEIIVNDQGNRVTPSIVAFTASERL
B8LRY5_______________IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain