UniGene Name: sp_v3.0_unigene81070
Length: 206 nt
![]() |
---|
>sp_v3.0_unigene81070
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Caffeate O-methyltransferase n=4 Tax=Picea RepID=Q5NDD5_PICAB | - | - | 5.0e-25 | 85% |
FL-Next | tr=Caffeic acid O-3-methyltransferase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 87% |
Sma3 | Caffeic acid 3-O-methyltransferase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Catechol O-methyltransferase. | EC:2.1.1.6 | - | 7.813e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Steroid hormone biosynthesis | 00140 | 7.813e-08 | % | |
Sma3 | Tyrosine metabolism | 00350 | 7.813e-08 | % | |
Sma3 | Betalain biosynthesis | 00965 | 7.813e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 7.813e-08 | % | |
Sma3 | Caffeate O-methyltransferase. | EC:2.1.1.68 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
Sma3 | Quercetin 3-O-methyltransferase. | EC:2.1.1.76 | - | 1.124e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavone and flavonol biosynthesis | 00944 | 1.124e-06 | % |
Source | Gene names |
---|---|
Sma3 | At1g77520; At1g77530; At5g53810; At5g54160; BMT; COMT; COMT1; COMT2; COMT3; COMT4; COMT5; COMT6; Ec70MT; GSVIVT00000478001; GSVIVT00000479001; GSVIVT00003518001; GSVIVT00005864001; GSVIVT00015403001; GSVIVT00025990001; GSVIVT00025994001; GSVIVT00026177001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
Sma3 | catechol O-methyltransferase activity | GO:0016206 | Molecular Function | 0.0 | - |
Sma3 | 5-hydroxyfuranocoumarin 5-O-methyltransferase activity | GO:0030752 | Molecular Function | 0.0 | - |
Sma3 | quercetin 3-O-methyltransferase activity | GO:0030755 | Molecular Function | 0.0 | - |
Sma3 | myricetin 3'-O-methyltransferase activity | GO:0033799 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | caffeate O-methyltransferase activity | GO:0047763 | Molecular Function | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
Sma3 | O-methyltransferase, family 2 | IPR001077 | - | 0.0 | - |
Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
Sma3 | Plant methyltransferase dimerisation | IPR012967 | - | 0.0 | - |
Sma3 | O-methyltransferase, COMT, eukaryota | IPR016461 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G77530.1 | O-methyltransferase family protein chr1:29136037-29137423 FORWARD LENGTH=381 | 1.0e-22 | 63% |
RefSeq | Arabidopsis thaliana | NP_177877.1 | O-methyltransferase family protein [Arabidopsis thaliana] | 2.0e-22 | 63% |
RefSeq | Populus trichocarpa | XP_002302677.1 | catechol o-methyltransferase [Populus trichocarpa] | 2.0e-23 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G3C8Z7
Fln msg: Distance to subject end: 90 aas, your sequence is shorter than subject: 68 - 364
Fln protein:
C
Protein Length:
69
Fln nts:
A
Fln Alignment:
GDTE5QK01CSDYW___STLNLIVSRYPHISAINFDMAHVVADAPHYPAVKHVSGDMFDSVPSGEAVFKKSILHDWSDD
G3C8Z7_______________STLNLIVSKYPHISGINFDMPHVVADAPHYPAVKHVGGDMFDSVPSGQAIFMKWILHDWSDD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain