UniGene Name: sp_v3.0_unigene80956
Length: 218 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene80956
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Clavata-like receptor n=1 Tax=Picea glauca RepID=Q19AV8_PICGL | - | - | 1.0e-14 | 80% |
FL-Next | sp=Receptor-like protein kinase HAIKU2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
Sma3 | Receptor protein kinase CLAVATA1, putative | - | - | 6.666e-25 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 2.267e-14 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 3.141e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT1G28440; AT3G49670; AT4G28490; AT4G28650; AT5G65700; AT5G65710; At1g28440; At1g72180; At3g19700; At3g49670; At4g28490; At4g28650; At5g65700; CLL1A; CLL1B; CLL6; CLV; CLV1A; CLV1B; CM0216.560.nc; F21O9.180; F6H11.160; F6H11.170; GSVIVT00003044001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | aminopeptidase activity | GO:0004177 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
Sma3 | endosperm development | GO:0009960 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha/beta hydrolase fold-1 | IPR000073 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
Sma3 | Peptidase S33 | IPR002410 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Proline iminopeptidase | IPR005944 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G19700.1 | IKU2 Leucine-rich repeat protein kinase family protein chr3:6843662-6846791 FORWARD LENGTH=991 | 6.0e-15 | 63% |
RefSeq | Arabidopsis thaliana | NP_188604.1 | receptor-like protein kinase HAIKU2 [Arabidopsis thaliana] | 7.0e-15 | 63% |
RefSeq | Populus trichocarpa | XP_002313944.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 73% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LJM4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 80 aas, your sequence is shorter than subject: 72 - 991
Fln protein:
T
Protein Length:
73
Fln nts:
C
Fln Alignment:
GDTE5QK01ELSIZ___IAVIVSVYAYTLKVNEKSDIYSFGVVILELVTGRQPIDPEFGENKDI
Q9LJM4_______________LGYIAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPLETDFGENNDI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain