|
||||||
|
UniGene Name: sp_v3.0_unigene80838
Length: 178 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80838
G |
|
Ace file of the UniGene sp_v3.0_unigene80838
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phospholipid-transporting ATPase, putative n=1 Tax=Ricinus communis RepID=B9SF77_RICCO | - | - | 2.0e-09 | 66% |
| FL-Next | sp=Phospholipid-transporting ATPase 10; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Sma3 | Phospholipid-transporting ATPase, putative | - | - | 1.32e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 6.453e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | ALA10; ALA11; ALA12; ALA9; At1g13210; At1g26130; At1g68710; At3g25610; F14G11.10; F24J5.6; F28B23.19; F3F19.24; GSVIVT00020729001; GSVIVT00030242001; OsI_18075; OsJ_16768; POPTRDRAFT_421641; RCOM_1095380; RCOM_1464220; T5M7.5; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G25610.1 | ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein chr3:9308942-9313353 REVERSE LENGTH=1202 | 5.0e-13 | 66% |
| RefSeq | Arabidopsis thaliana | NP_189189.1 | phospholipid-transporting ATPase 10 [Arabidopsis thaliana] | 6.0e-13 | 66% |
| RefSeq | Populus trichocarpa | XP_002311411.1 | aminophospholipid ATPase [Populus trichocarpa] | 5.0e-13 | 59% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LI83
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 432 aas, your sequence is shorter than subject: 52 - 1202
Fln protein:
V
Protein Length:
53
Fln nts:
G
Fln Alignment:
GDTE5QK01AIQ5X___VAMCIHSLLEAGIKIWVLTGDKLETAINVGYAACLLSPETRQIII
Q9LI83_______________VPECIDKLAQAGIKIWVLTGDKMETAINIGFASSLLRQEMKQIII
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
