|
||||||
|
UniGene Name: sp_v3.0_unigene80813
Length: 203 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene80813
C |
|
Ace file of the UniGene sp_v3.0_unigene80813 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Medium chain fatty acid hydroxylase n=2 Tax=Selaginella moellendorffii RepID=D8S8T6_SELML | - | - | 3.0e-16 | 60% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
| Sma3 | Putative cytochrome P450 | - | - | 2.982e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 3.677e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 3.677e-11 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 3.677e-11 | % | |
| Sma3 | Caffeine metabolism | 00232 | 3.677e-11 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 3.677e-11 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 3.677e-11 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 3.677e-11 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 3.677e-11 | % | |
| Sma3 | Retinol metabolism | 00830 | 3.677e-11 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 3.677e-11 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 3.677e-11 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 3.677e-11 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 3.677e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.677e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g01600; At1g01600/F22L4_10; At1g13150; At2g27690; At2g27690/F15K20.21; At2g44890; At2g45510; At2g45970; At5g23190; At5g58860; B0103C08-B0602B01.11; B1096A10.16; CYP704A11; CYP704A14; CYP86; CYP86A1; CYP86A20; CYP94A1; CYP94A14; CYP94A2; CYP94A3; CYP94A |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | suberin biosynthetic process | GO:0010345 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-1 | IPR013078 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G27690.1 | CYP94C1 cytochrome P450, family 94, subfamily C, polypeptide 1 chr2:11809373-11810860 FORWARD LENGTH=495 | 1.0e-21 | 59% |
| RefSeq | Arabidopsis thaliana | NP_180337.1 | cytochrome P450, family 94, subfamily C, polypeptide 1 [Arabidopsis thaliana] | 2.0e-21 | 59% |
| RefSeq | Populus trichocarpa | XP_002319770.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-20 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LML7
Fln msg: Distance to subject end: 60 aas, your sequence is shorter than subject: 67 - 456
Fln protein:
L
Protein Length:
68
Fln nts:
C
Fln Alignment:
GDTE5QK01B6U69___LDSKIASNDDVLPDGTTVSTGSFVAYNIYAMGRMEGIWGKDFMEFRPERWLSIDGSFEMKNPFKFAV
B8LML7_______________VDTKVAATDDVLPDGTVVPRGWFVSYSIYSMGRMESIWGGDFMDFRPERWLK-DGEFVGENPYKFTV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
