|
||||||
|
UniGene Name: sp_v3.0_unigene80412
Length: 201 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80412
G |
|
Ace file of the UniGene sp_v3.0_unigene80412
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cdc2-like protein kinase [Beta vulgaris subsp. vulgaris] | - | - | 7.0e-24 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 41% |
| Sma3 | Cell division protein kinase, putative | - | - | 2.616e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | [RNA-polymerase]-subunit kinase. | EC:2.7.11.23 | - | 1.345e-21 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g10010; AT4g22940; AT5G44290; At1g03740; At1g18670; At1g33770; At1g53050; At1g54610; At1g57700; At1g74330; At3g01085; At3g05050; At4g10010; At4g10010/T5L19_140; At5g44290; At5g50860; At5g50860/K16E14_2; B1329D01.21; CDC2CAt; F14J9.26; F14M2.11; F1M20.1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
| Sma3 | Xylan biosynthesis protein IRX15/IRX15L | IPR006514 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G54610.2 | - | 1.0e-27 | 75% |
| RefSeq | Arabidopsis thaliana | NP_001117490.1 | putative serine/threonine-protein kinase [Arabidopsis thaliana] | 1.0e-27 | 75% |
| RefSeq | Populus trichocarpa | XP_002319597.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-30 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXN0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 411 aas, your sequence is shorter than subject: 66 - 575
Fln protein:
R
Protein Length:
67
Fln nts:
G
Fln Alignment:
GDTE5QK01DGHGB___RRLDHPNVVKLEGLVTS--------------RMSCSLYLVFEYMEHDLAGLAASPGSTFTEP-------QLLSGLEHCH
A9NXN0_______________KKLQHENVIKLKEIVTSPGPEKDEQGKSDGNKYNGSIYMVFEYMDHDLTGLAERPGMRFSVPQIKCYMKQLLIGLHYCH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
