|
||||||
|
UniGene Name: sp_v3.0_unigene80009
Length: 215 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene80009
G |
|
Ace file of the UniGene sp_v3.0_unigene80009
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pyruvate decarboxylase n=3 Tax=Rosaceae RepID=B0ZS79_PRUAR | - | - | 1.0e-24 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Pyruvate decarboxylase | - | - | 1.964e-36 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate decarboxylase. | EC:4.1.1.1 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g33070; At4g33070; At5g01320; At5g01330; At5g54960; CHLREDRAFT_127786; GSVIVT00001355001; GSVIVT00024065001; GSVIVT00035905001; OSJNBa0052E20.3; Os01g0160100; Os05g0469800; OsI_00500; OsI_010826; OsI_026469; OsI_11123; OsI_20291; OsI_27437; OsJ_00466; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | pyruvate decarboxylase activity | GO:0004737 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | carboxy-lyase activity | GO:0016831 | Molecular Function | 0.0 | - |
| Sma3 | thiamine pyrophosphate binding | GO:0030976 | Molecular Function | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | TPP-binding enzyme, conserved site | IPR000399 | - | 0.0 | - |
| Sma3 | Thiamine pyrophosphate enzyme, C-terminal TPP-binding | IPR011766 | - | 0.0 | - |
| Sma3 | Thiamine pyrophosphate enzyme, central domain | IPR012000 | - | 0.0 | - |
| Sma3 | Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain | IPR012001 | - | 0.0 | - |
| Sma3 | Pyruvate decarboxylase/indolepyruvate decarboxylase | IPR012110 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G01320.1 | Thiamine pyrophosphate dependent pyruvate decarboxylase family protein chr5:129484-131625 REVERSE LENGTH=603 | 1.0e-30 | 83% |
| RefSeq | Arabidopsis thaliana | NP_195752.1 | pyruvate decarboxylase [Arabidopsis thaliana] | 1.0e-30 | 83% |
| RefSeq | Populus trichocarpa | XP_002322997.1 | predicted protein [Populus trichocarpa] | 1.0e-29 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRN0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 43 aas, your sequence is shorter than subject: 71 - 409
Fln protein:
L
Protein Length:
72
Fln nts:
G
Fln Alignment:
GD4IA4404II4RP___GRILSFFLINNGGYTIEVEIHDGPYNVIRNWNYTGLVDAPIHNGEGKCWTVKVKTEEGLVEAIKT
C0PRN0_______________GQNTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDA-LHNGEGKCWTVKVKTEEEVVEAIKT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
