UniGene Name: sp_v3.0_unigene79768
Length: 242 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene79768
C |
Ace file of the UniGene sp_v3.0_unigene79768 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | UTP-glucose-1-phosphate uridylyltransferase n=2 Tax=Agaricales RepID=B0D8B2_LACBS | - | - | 5.0e-29 | 77% |
FL-Next | tr=UDP-glucose pyrophosphorylase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 52% |
Sma3 | UDP-glucose pyrophosphorylase | - | - | 1.17e-34 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UTP--glucose-1-phosphate uridylyltransferase. | EC:2.7.7.9 | - | 1.079e-36 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose and glucuronate interconversions | 00040 | 1.079e-36 | % | |
Sma3 | Galactose metabolism | 00052 | 1.079e-36 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 1.079e-36 | % | |
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 1.079e-36 | % | |
Sma3 | Metabolic pathways | 01100 | 1.079e-36 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.079e-36 | % |
Source | Gene names |
---|---|
Sma3 | At5g17310; GSVIVT00034877001; MKP11.16; NtUGPase; OsI_32322; RCOM_1605130; UGP; UGP1; UGPA; ugp; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | UTP:glucose-1-phosphate uridylyltransferase activity | GO:0003983 | Molecular Function | 0.0 | - |
Sma3 | nucleotidyltransferase activity | GO:0016779 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S2 | IPR001865 | - | 0.0 | - |
Sma3 | UTP--glucose-1-phosphate uridylyltransferase | IPR002618 | - | 0.0 | - |
Sma3 | UTP--glucose-1-phosphate uridylyltransferase, subgroup | IPR016267 | - | 0.0 | - |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G17310.2 | - | 4.0e-21 | 52% |
RefSeq | Arabidopsis thaliana | NP_850837.1 | UTP--glucose-1-phosphate uridylyltransferase 1 [Arabidopsis thaliana] | 2.0e-21 | 52% |
RefSeq | Populus trichocarpa | XP_002327599.1 | predicted protein [Populus trichocarpa] | 6.0e-20 | 51% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A6N839
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 80 - 480
Fln protein:
R
Protein Length:
81
Fln nts:
C
Fln Alignment:
GD4IA4404JUQUH___RFLPVKSCSDLLLIRSNIYSLQNGQLHMSEGRMFGSVPVIKLGDHFKKISEFQSRFKKIPNIIDLDHLTVTGDVHFGRGV
A6N839_______________RFLPVKATSDLLLVQSDLYTVEEGFVIRNPARVNPTNPTIELGPEFKKVGNFLKRFKSIPSIIDLDSLKVSGDVWFGSGV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain