UniGene Name: sp_v3.0_unigene79504
Length: 200 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene79504
T |
Ace file of the UniGene sp_v3.0_unigene79504 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein kinase-like protein [Arabidopsis thaliana] gb|AAC09037.1| putative protein kinase [Arabidopsis thaliana] gb|AAT99800.1| At2g18890 [Arabidopsis thaliana] gb|AAU94416.1| At2g18890 [Arabidopsis thaliana] gb|AEC06821.1| protein kinase-like protein [Ar | - | - | 7.0e-23 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | ATP binding protein, putative | - | - | 2.385e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT1G60800; At1g21590; At1g26150; At1g60800; At2g18890; At3g05140; At5g10520; At5g18910; At5g18910/F17K4_160; At5g35960; At5g57670; At5g65530/K21L13_3; F12B17_130; F24J8.18; F28B23.17; F8A5.31; GSVIVT00002709001; GSVIVT00004178001; GSVIVT00004248001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | endomembrane system | GO:0012505 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | structural molecule activity | GO:0005198 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Sma3 | defense response, incompatible interaction | GO:0009814 | Biological Process | 0.0 | - |
Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G18890.1 | Protein kinase superfamily protein chr2:8184027-8186685 FORWARD LENGTH=392 | 8.0e-30 | 80% |
RefSeq | Arabidopsis thaliana | NP_001031373.1 | protein kinase-like protein [Arabidopsis thaliana] | 4.0e-30 | 80% |
RefSeq | Populus trichocarpa | XP_002325078.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-32 | 84% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9D1
Fln msg: Distance to subject end: 152 aas, your sequence is shorter than subject: 66 - 347
Fln protein:
S
Protein Length:
67
Fln nts:
T
Fln Alignment:
GD4IA4404JBDR2___KVALGTARGLHYLHKCCKRRIIHRDIKASNVLLGPDFEPQISDFGLAKWLPRQWSHH
D5A9D1_______________KVAIGTARGLHYLHKCCQRRIIHRDIKSSNVLLGKDFEPQISDFGLSKWLPRQWTHH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain