UniGene Name: sp_v3.0_unigene79160
Length: 224 nt
UniGene Fasta |
---|
>sp_v3.0_unigene79160
A |
Ace file of the UniGene sp_v3.0_unigene79160 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Inwardly rectifying potassium channel subunit n=1 Tax=Daucus carota RepID=Q6ZXS4_DAUCA | - | - | 5.0e-19 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 40% |
Sma3 | Putative AKT1-like potassium channel | - | - | 4.885e-08 | - |
Source | Gene names |
---|---|
Sma3 | AKT1; AKT5; AKT6; AT2G26650; At2g25600; At2g26650; At4g32500; DKT1; EcKT1-1; EcKT1-2; F18A8.2; F3N11.5; F8B4.200; GSVIVT00016836001; GSVIVT00032597001; LKT1; NKT1; OJ1656_E11.135; OsI_03064; OsI_25085; OsJ_02815; OsJ_23288; POPTRDRAFT_260956; POPTRDRAFT_4 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ion channel activity | GO:0005216 | Molecular Function | 0.0 | - |
Sma3 | inward rectifier potassium channel activity | GO:0005242 | Molecular Function | 0.0 | - |
Sma3 | voltage-gated potassium channel activity | GO:0005249 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyclic nucleotide-binding domain | IPR000595 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Potassium channel, voltage-dependent, EAG/ELK/ERG | IPR003938 | - | 0.0 | - |
Sma3 | Ion transport | IPR005821 | - | 0.0 | - |
Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
Sma3 | Cyclic nucleotide-binding, conserved site | IPR018488 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G26650.1 | AKT1, ATAKT1, KT1 K+ transporter 1 chr2:11331965-11336444 REVERSE LENGTH=857 | 3.0e-23 | 59% |
RefSeq | Arabidopsis thaliana | NP_180233.1 | Potassium channel AKT1 [Arabidopsis thaliana] | 3.0e-23 | 59% |
RefSeq | Populus trichocarpa | XP_002309603.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-23 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PS80
Fln msg: Distance to subject end: 58 aas, your sequence is shorter than subject: 74 - 354
Fln protein:
A
Protein Length:
75
Fln nts:
A
Fln Alignment:
GD4IA4404JTSR0___DVPVSLCFVASIGDTLLMEQLLKNGMDPNESDSNSRTPLHIATAYGLEDCVKLLLQYGADVNSKDEDGS
C0PS80_______________ETPLTLTHVASTGDVKELQSLLAKGVDKDKKDSQGRTALHFACGYGNARCVEVLLEAGALVDPLDKNNN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain