|
||||||
|
UniGene Name: sp_v3.0_unigene78976
Length: 246 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78976
G |
|
Ace file of the UniGene sp_v3.0_unigene78976
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DnaJ protein homolog ANJ1 n=1 Tax=Atriplex nummularia RepID=DNJH_ATRNU | - | - | 1.0e-13 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | DnaJ protein | - | - | 3.211e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | A2; A3; ATJ; ATJ2; ATJ3; At3g44110; At5g22060; B38; DNAJ1; F26G5.60; GSVIVT00002640001; GSVIVT00019136001; GSVIVT00037272001; J3; LDJ2; LOC_Os03g44620; LOC_Os03g57340; OSIGBa0134H18.3; OSJNBb0024J04.9; OSJNBb0034G17.1; Os02g0656500; Os03g0648400; Os03g078 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | heat shock protein binding | GO:0031072 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ, cysteine-rich domain | IPR001305 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
| Sma3 | Chaperone DnaJ, C-terminal | IPR002939 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ | IPR003095 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | IPR015609 | - | 0.0 | - | |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G44110.1 | ATJ3, ATJ DNAJ homologue 3 chr3:15869115-15871059 REVERSE LENGTH=420 | 9.0e-15 | 61% |
| RefSeq | Arabidopsis thaliana | NP_189997.1 | chaperone protein dnaJ 3 [Arabidopsis thaliana] | 1.0e-14 | 61% |
| RefSeq | Populus trichocarpa | XP_002316479.1 | predicted protein [Populus trichocarpa] | 8.0e-19 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NK86
Fln msg: your sequence is shorter than subject: 78 - 189
Fln protein:
A
Protein Length:
79
Fln nts:
G
Fln Alignment:
GD4IA4404IYSHR___ELDECEETTLHDVNLEEEMRKK--QSQQEAYEEDEEGSGGPRVQCAQQ
A9NK86_______________ELDECEETTLHDVNIEDELRRKQQQQQQEAYEEDDEPQ-GHRVQCAQQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
