UniGene Name: sp_v3.0_unigene78779
Length: 220 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78779
G |
Ace file of the UniGene sp_v3.0_unigene78779 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Lipoxygenase (Fragment) n=5 Tax=Vitis vinifera RepID=D7U236_VITVI | - | - | 5.0e-25 | 70% |
FL-Next | sp=Lipoxygenase; Taxus wallichiana var. chinensis (Chinese yew) (Taxus chinensis). | - | - | 0.0 | 76% |
Sma3 | Lipoxygenase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipoxygenase. | EC:1.13.11.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Linoleic acid metabolism | 00591 | 0.0 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g17420; At1g55020; At1g72520; B1168A08.24; B1168A08.28-1; B1168A08.28-2; CM-LOX1; CM-LOX2; F14C21.3; F14C21.54; F28G4.10; F28P22.29; GSVIVT00008869001; GSVIVT00013309001; GSVIVT00019960001; GSVIVT00022800001; GSVIVT00022801001; GSVIVT00024672001; LOC_O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | lipoxygenase activity | GO:0016165 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Lipoxygenase | IPR000907 | - | 0.0 | - |
Sma3 | Lipoxygenase, LH2 | IPR001024 | - | 0.0 | - |
Sma3 | Lipoxygenase, plant | IPR001246 | - | 0.0 | - |
Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G22400.1 | LOX5 PLAT/LH2 domain-containing lipoxygenase family protein chr3:7927011-7931167 FORWARD LENGTH=886 | 6.0e-30 | 63% |
RefSeq | Arabidopsis thaliana | NP_188879.2 | lipoxygenase 5 [Arabidopsis thaliana] | 8.0e-30 | 63% |
RefSeq | Populus trichocarpa | XP_002315780.1 | predicted protein [Populus trichocarpa] | 8.0e-30 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G9L7U0
Fln msg: Distance to subject end: 115 aas, your sequence is shorter than subject: 73 - 855
Fln protein:
G
Protein Length:
74
Fln nts:
G
Fln Alignment:
GD4IA4403F1XQO___GHGDKRDETWWYSIETVEELEKALTTIIWVASALHAAVNFGQYPYAGYIPNRPTITRRFIPEEGSQEFSQMVE
G9L7U0_______________GHGDHKDATWWYQMQSVKELEKALTTIIWVASALHAAVNFGQYAYAGYMPNRPTMSRKWIPEEGSKEFAQLVE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain