UniGene Name: sp_v3.0_unigene78778
Length: 248 nt
![]() |
---|
>sp_v3.0_unigene78778
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Tau class glutathione S-transferase n=2 Tax=Pinus RepID=D3YLT8_9CONI | - | - | 1.0e-21 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Glutathione S-transferase | - | - | 1.898e-34 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione transferase. | EC:2.5.1.18 | - | 6.12e-27 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione metabolism | 00480 | 6.12e-27 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 6.12e-27 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 6.12e-27 | % | |
Sma3 | Lactoylglutathione lyase. | EC:4.4.1.5 | - | 1.686e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyruvate metabolism | 00620 | 1.686e-13 | % |
Source | Gene names |
---|---|
Sma3 | At1g17170; At1g17180; At1g17180/F20D23_12; At1g17190; At1g78320; At1g78340; At1g78340/F3F9_13; At1g78360; At1g78370; At1g78380; BI-GST/GPX; C-7; EgHypar; F20D23.11; F20D23.12; F20D23.13; GST; GST1; GST1a; GST1b; GST2; GST5; GSTU1; GSTU2; GSTU6; GSTa; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
Sma3 | lactoylglutathione lyase activity | GO:0004462 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | glutathione binding | GO:0043295 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to herbicide | GO:0009635 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | cellular response to water deprivation | GO:0042631 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G78320.1 | ATGSTU23, GSTU23 glutathione S-transferase TAU 23 chr1:29467581-29468358 REVERSE LENGTH=220 | 7.0e-21 | 63% |
RefSeq | Arabidopsis thaliana | NP_177955.1 | glutathione S-transferase TAU 23 [Arabidopsis thaliana] | 9.0e-21 | 63% |
RefSeq | Populus trichocarpa | XP_002317608.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NSK9
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 79 aas, your sequence is shorter than subject: 82 - 229
Fln protein:
V
Protein Length:
83
Fln nts:
C
Fln Alignment:
GD4IA4403FOJ9L___VLIHNGEPVCESLIILQYIDEVWPGTNSFMPSNPYDRAIARFWADFLDTKxxxxVLGRLSRH*GEGQEEGKRYMLEYLGLLEGVLKEFSAGGSKP
A9NSK9_______________VLIHNGKPICESLIILQYMDEVWPGSNSLLPSNPYDRALARFWADFLDTKxxxxVVDKIFKCTGEGQEEGTRYMLEYLGLLE---RELSAGEGKP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain