SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene78650

Length: 285 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene78650
AACCGAAGGACATCGAAAAGCAGATCAGGGATATGCTCTTGAAGTATGTTTCGAAGCCGAGTTGTATCATTCTGGCCGTCACGCCTGGTAATCAGGATTTGGCGAACTCGGATGGGTTGAAGCTGGCGAGAGAGGTCGACCCGGAGGGAACGAGGACAATAGGCGTCTTAACCAAGATCGATCTCATGGATTCTGGAACTGACGTTGTTGACATCCTAGCCGGGCGGGTCATTCCTCTGAGGTTGGGCTACGTTCCGGTGGTGAACCGAGGGCAGAGAGATATCG

Ace file of the UniGene sp_v3.0_unigene78650 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	VpsA protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHB0_COPC7	-	-	1.99993e-41	89%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	56%
Sma3	Dynamin, putative	-	-	1.848e-24	-

Source	Gene names
Sma3	ADL1; ADL1A; ADL1B; ADL1C; ADL1D; ADL1E; ADL2; ADL2A; ADL2B; ADL4; ADL5; AG68; At1g14830; At2g14120; At2g44590; At3g60190; At3g61760; At4g33650; At5g42080; B1130E07.11; B1331F11.31; B1793G04.8-1; CHLREDRAFT_195430; CHLREDRAFT_195431; DLP1; DLP2; DLP3; DRP

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	microtubule	GO:0005874	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	cell cortex	GO:0005938	Cellular Component	-
Sma3	cell plate	GO:0009504	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	motor activity	GO:0003774	Molecular Function	-
Sma3	GTPase activity	GO:0003924	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	branched-chain-amino-acid transaminase activity	GO:0004084	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	GTP binding	GO:0005525	Molecular Function	-
Sma3	phosphatidylinositol binding	GO:0035091	Molecular Function	-
Sma3	mitochondrial fission	GO:0000266	Biological Process	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	cell cycle	GO:0007049	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	cell plate formation involved in plant-type cell wall biogenesis	GO:0009920	Biological Process	-
Sma3	xylem and phloem pattern formation	GO:0010051	Biological Process	-
Sma3	trichome branching	GO:0010091	Biological Process	-
Sma3	pollen maturation	GO:0010152	Biological Process	-
Sma3	peroxisome fission	GO:0016559	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-
Sma3	cell division	GO:0051301	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Dynamin central domain	IPR000375	-	-
Sma3	G-patch domain	IPR000467	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Dynamin, GTPase domain	IPR001401	-	-
Sma3	Dynamin GTPase effector	IPR003130	-	-
Sma3	Dynamin, GTPase region, conserved site	IPR019762	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G14120.3	-	6.0e-34	62%
RefSeq	Arabidopsis thaliana	NP_565362.1	dynamin-related protein 3B [Arabidopsis thaliana]	7.0e-34	62%
RefSeq	Populus trichocarpa	XP_002318292.1	predicted protein, partial [Populus trichocarpa]	1.0e-35	61%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LS11

Fln msg: Distance to subject end: 362 aas, your sequence is shorter than subject: 94 - 615

Fln protein: PKDIEKQIRDMLLKYVSKPSCIILAVTPGNQDLANSDGLKLAREVDPEGTRTIGVLTKIDLMDSGTDVVDILAGRVIPLRLGYVPVVNRGQRDI

Protein Length: 95

Fln nts: AACCGAAGGACATCGAAAAGCAGATCAGGGATATGCTCTTGAAGTATGTTTCGAAGCCGAGTTGTATCATTCTGGCCGTCACGCCTGGTAATCAGGATTTGGCGAACTCGGATGGGTTGAAGCTGGCGAGAGAGGTCGACCCGGAGGGAACGAGGACAATAGGCGTCTTAACCAAGATCGATCTCATGGATTCTGGAACTGACGTTGTTGACATCCTAGCCGGGCGGGTCATTCCTCTGAGGTTGGGCTACGTTCCGGTGGTGAACCGAGGGCAGAGAGATATCG

Fln Alignment:

GD4IA4403GP12X___PKDIEKQIRDMLLKYVSKPSCIILAVTPGNQDLANSDGLKLAREVDPEGTRTIGVLTKIDLMDSGTDVVDILAGRVIPLRLGYVPVVNRGQRDI
B8LS11_______________PESIVGDIENMVRSYVDKPNCLILAISPANQDIATSDAIKLAREVDPSGDRTFGVLTKLDLMDKGTNAIDVLDGRAYRLQHPWVGVANRSQADI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain