|
||||||
|
UniGene Name: sp_v3.0_unigene78578
Length: 220 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene78578
G |
|
Ace file of the UniGene sp_v3.0_unigene78578 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cinnamate 4-hydroxylase (Fragment) n=2 Tax=Pinus taeda RepID=Q5IDA4_PINTA | - | - | 1.0e-31 | 98% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | Cinnamic acid 4-hydroxylase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Trans-cinnamate 4-monooxygenase. | EC:1.14.13.11 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Flavonoid biosynthesis | 00941 | 0.0 | % | |
| Sma3 | Stilbenoid, diarylheptanoid and gingerol biosynthesis | 00945 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | BcCyp450; C4H; C4H-1; C4H-2; C4H1; C4H1-1; C4H1-2; C4H2; C4H2-1; C4H2-2; C4H2|CYP73A42; C4H3; CYP73; CYP73A1; CYP73A10; CYP73A11; CYP73A12; CYP73A13; CYP73A14; CYP73A16; CYP73A19; CYP73A2; CYP73A27; CYP73A28; CYP73A3; CYP73A4; CYP73A43|C4H1; CYP73A5; CYP7 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | trans-cinnamate 4-monooxygenase activity | GO:0016710 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G30490.1 | ATC4H, C4H, CYP73A5, REF3 cinnamate-4-hydroxylase chr2:12993861-12995683 REVERSE LENGTH=505 | 7.0e-30 | 88% |
| RefSeq | Arabidopsis thaliana | NP_180607.1 | trans-cinnamate 4-monooxygenase [Arabidopsis thaliana] | 1.0e-29 | 88% |
| RefSeq | Populus trichocarpa | XP_002325637.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-29 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRW0
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 102 aas, your sequence is shorter than subject: 73 - 228
Fln protein:
E
Protein Length:
74
Fln nts:
G
Fln Alignment:
GD4IA4403HFUHE___ENINVAAIETTLWSMEWGIAELVNHQEIQSKVRAELDAVLGPGVQITEPDTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxHDAKLGGYDIPAESKILVNAWWL
B8LRW0_______________ENINVAAIETTLWSMEWAIAELVNHQDIQNKVRAELEAVLGHGVQITEPDTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxHDAKLGGYDIPAESKILVNAWWL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
