UniGene Name: sp_v3.0_unigene78399
Length: 222 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78399
C |
Ace file of the UniGene sp_v3.0_unigene78399 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Cysteine-rich receptor-like protein kinase 1; Short=Cysteine-rich RLK1; AltName: Full=Receptor-like kinase in flowers 2; Flags: Precursor | - | - | 5.0e-09 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Source | Gene names |
---|---|
Sma3 | At1g19090; B1070A12.4; BcRK6; CRK1; F14D16.24; GSVIVT00023436001; GSVIVT00033130001; GSVIVT00038753001; LOC_Os10g34220; LOC_Os11g28104; MtrDRAFT_AC149642g16v2; OJ1210_A07.32; OSJNBa0012L23.52; Os01g0784200; Os10g0483400; Os11g0470200; OsI_04007; OsI_04008 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Ribosomal protein S6e, conserved site | IPR018282 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G19090.1 | RKF2, CRK1 receptor-like serine/threonine kinase 2 chr1:6590350-6592615 FORWARD LENGTH=600 | 8.0e-13 | 68% |
RefSeq | Arabidopsis thaliana | NP_564071.3 | receptor-like serine/threonine kinase 2 [Arabidopsis thaliana] | 1.0e-12 | 68% |
RefSeq | Populus trichocarpa | XP_002339073.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-13 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 50 aas, your sequence is shorter than subject: 49 - 505
Fln protein:
N
Protein Length:
50
Fln nts:
C
Fln Alignment:
GD4IA4403FOZE1___NLITRVQHRNLVRLLGCSVQTSERLLVYEYLHNSSLDKIIF
B8LLJ5_______________NLISRVQHRNLVKLLGCSVENSERLLVYEYLQNSSLDKIIF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain