|
||||||
|
UniGene Name: sp_v3.0_unigene78153
Length: 201 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene78153
A |
|
Ace file of the UniGene sp_v3.0_unigene78153 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peroxisome biosynthesis protein (PAS8/Peroxin-6), putative n=2 Tax=Neosartorya RepID=Q4WX27_ASPFU | - | - | 1.0e-28 | 96% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
| Sma3 | Cell division cycle protein 48 | - | - | 9.783e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 3.759e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G09840; AatP; At1g03000; At3g01610; At3g09840; At3g53230; At5g03340; CAFP; CDC48; CDC48A; CDC48C; CDC48D; CDC48E; CHLREDRAFT_113394; CHLREDRAFT_134171; CHLREDRAFT_38371; EMB1354; F10O3.18; F12E4_70; F4P13.15; GSVIVT00016023001; GSVIVT00023232001; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | cytoskeleton | GO:0005856 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
| Sma3 | metalloendopeptidase activity | GO:0004222 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | - |
| Sma3 | peroxisome organization | GO:0007031 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | protein import into peroxisome matrix | GO:0016558 | Biological Process | 0.0 | - |
| Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Peptidase M41 | IPR000642 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | IPR001984 | - | 0.0 | - | |
| Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
| Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
| Sma3 | Peptidase, FtsH | IPR005936 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, CDC48 | IPR005938 | - | 0.0 | - |
| Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Peptidase M41, FtsH extracellular | IPR011546 | - | 0.0 | - |
| Sma3 | Peroxisome biogenesis factor 1, N-terminal | IPR015342 | - | 0.0 | - |
| Sma3 | Vps4 oligomerisation, C-terminal | IPR015415 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | L-lactate dehydrogenase, active site | IPR018177 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G03000.1 | PEX6 peroxin 6 chr1:688057-692453 REVERSE LENGTH=941 | 3.0e-28 | 73% |
| RefSeq | Arabidopsis thaliana | NP_171799.2 | peroxin 6 [Arabidopsis thaliana] | 4.0e-28 | 73% |
| RefSeq | Populus trichocarpa | XP_002321026.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-29 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACE6
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 66 - 442
Fln protein:
E
Protein Length:
67
Fln nts:
A
Fln Alignment:
GD4IA4403HCOC9___GILFYGPPGTGKTLLAKAIATEFSLNFFSVKGPELLNMYVGESEANVRRVFQRA
D5ACE6_______________GVLMFGPPGCSKTIMARAVASEAGLNFLAVKGPELFSKWVGESEKAIQSLFAKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
