UniGene Name: sp_v3.0_unigene78098
Length: 244 nt
![]() |
---|
>sp_v3.0_unigene78098
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Receptor protein kinase n=1 Tax=Pinus sylvestris RepID=Q9FEU2_PINSY | - | - | 2.0e-27 | 80% |
FL-Next | tr=Receptor protein kinase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 80% |
Sma3 | Receptor protein kinase CLAVATA1, putative | - | - | 1.551e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 3.2e-29 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.42e-18 | - |
Sma3 | EC:2.7.11.3- | - | 9.349e-07 | - |
Source | Gene names |
---|---|
Sma3 | 673I14.2; AT1G08590; AT1G34110; AT1G69270; AT1G75820; AT2G33170; AT3G49670; AT4G20270; AT4G28650; AT4g20270; AT4g32710; AT5G48940; AT5G49660; AT5G61480; AT5G63930; AT5G65700; AT5G65710; At1g08590; At1g09970; At1g09970/F21M12.36; At1g17230; At1g49270; At1g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | aminopeptidase activity | GO:0004177 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | epidermis development | GO:0008544 | Biological Process | 0.0 | - |
Sma3 | embryo sac development | GO:0009553 | Biological Process | 0.0 | - |
Sma3 | megasporogenesis | GO:0009554 | Biological Process | 0.0 | - |
Sma3 | microsporogenesis | GO:0009556 | Biological Process | 0.0 | - |
Sma3 | embryo development | GO:0009790 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | interspecies interaction between organisms | GO:0044419 | Biological Process | 0.0 | - |
Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
Sma3 | floral organ development | GO:0048437 | Biological Process | 0.0 | - |
Sma3 | tapetal layer development | GO:0048658 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G48940.1 | Leucine-rich repeat transmembrane protein kinase family protein chr5:19839785-19843744 FORWARD LENGTH=1135 | 8.0e-32 | 76% |
RefSeq | Arabidopsis thaliana | NP_199705.2 | LRR receptor-like serine/threonine-protein kinase RCH1 [Arabidopsis thaliana] | 1.0e-31 | 76% |
RefSeq | Populus trichocarpa | XP_002304699.1 | predicted protein [Populus trichocarpa] | 2.0e-32 | 78% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FEU2
Fln msg: Distance to subject end: 151 aas, your sequence is shorter than subject: 81 - 1145
Fln protein:
C
Protein Length:
82
Fln nts:
T
Fln Alignment:
GD4IA4403F65BT___HRDIKANNILLGTRYEPYIADFGLAKLLESSDFTKSSTHVAGSYGYIAPEYGYTMKITEKSDVYSYGVMLL
Q9FEU2_______________HRDVKANNILLGSQYEPYLADFGLAKLVDSADFNRSSTTVAGSYGYIAPEYGYTMKITQKIDVYSFGVVLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain