|
||||||
|
UniGene Name: sp_v3.0_unigene77980
Length: 198 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene77980
G |
|
Ace file of the UniGene sp_v3.0_unigene77980
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Strong similarity to gb|U04968 nucleotide excision repair protein (ERCC2) from Cricetulus grisseus [Arabidopsis thaliana] | - | - | 9.0e-18 | 87% |
| FL-Next | sp=DNA repair helicase UVH6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 87% |
| Sma3 | DNA repair helicase UVH6 | - | - | 7.91e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g03190; CHLREDRAFT_100548; ERCC2; F15K9.20; GSVIVT00023710001; MICPUCDRAFT_45209; MICPUN_56496; OSJNBb0015A05.1; OSTLU_26944; Os05g0144800; OsI_18432; OsJ_17093; Ot12g02930; PHATRDRAFT_54072; PHYPADRAFT_217649; POPTRDRAFT_551188; RCOM_0558550; THAPSDRA |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent DNA helicase activity | GO:0004003 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
| Sma3 | nucleotide-excision repair | GO:0006289 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Xeroderma pigmentosum group D protein | IPR001945 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
| Sma3 | Helicase-like, DEXD box c2 type | IPR006554 | - | 0.0 | - |
| Sma3 | ATP-dependent helicase, C-terminal | IPR006555 | - | 0.0 | - |
| Sma3 | DEAD2 | IPR010614 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1227 | IPR010643 | - | 0.0 | - |
| Sma3 | DNA helicase (DNA repair), Rad3 type | IPR013020 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type | IPR014013 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G03190.1 | ATXPD, UVH6 RAD3-like DNA-binding helicase protein chr1:775822-779863 FORWARD LENGTH=758 | 6.0e-23 | 87% |
| RefSeq | Arabidopsis thaliana | NP_849584.1 | DNA repair helicase UVH6 [Arabidopsis thaliana] | 8.0e-23 | 87% |
| RefSeq | Populus trichocarpa | XP_002300852.1 | predicted protein [Populus trichocarpa] | 4.0e-23 | 91% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8W4M7
Fln msg: Distance to subject end: 114 aas, your sequence is shorter than subject: 65 - 758
Fln protein:
S
Protein Length:
66
Fln nts:
G
Fln Alignment:
GD4IA4403GD8EX___FSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSRILRARLDYLRETF
Q8W4M7_______________FSVARGKVAEGIDFDRHYGRLVVMYGVPFQYTLSKILRARLEYLHDTF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
