UniGene Name: sp_v3.0_unigene77231
Length: 182 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene77231
G |
Ace file of the UniGene sp_v3.0_unigene77231
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gb|AEC07904.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | - | - | 5.0e-11 | 55% |
| FL-Next | tr=Predicted protein; Physcomitrella patens subsp. patens (Moss). | - | - | 0.0 | 70% |
| Source | Gene names |
|---|---|
| Sma3 | At2g26890; GSVIVT00016801001; LOC_Os10g42439; OSJNBa0003O19.5; Os10g0575200; OsI_34763; OsJ_32568; PHYPADRAFT_133871; PHYPADRAFT_163817; RCOM_0925750; VITISV_014674; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | late endosome | GO:0005770 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | trans-Golgi network | GO:0005802 | Cellular Component | 0.0 | - |
| Sma3 | heat shock protein binding | GO:0031072 | Molecular Function | 0.0 | - |
| Sma3 | protein targeting to vacuole | GO:0006623 | Biological Process | 0.0 | - |
| Sma3 | endosome organization | GO:0007032 | Biological Process | 0.0 | - |
| Sma3 | vacuole organization | GO:0007033 | Biological Process | 0.0 | - |
| Sma3 | amyloplast organization | GO:0009660 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | negative gravitropism | GO:0009959 | Biological Process | 0.0 | - |
| Sma3 | response to starvation | GO:0042594 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | VQ | IPR008889 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | IPR015609 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26890.1 | GRV2, KAM2 DNAJ heat shock N-terminal domain-containing protein chr2:11462327-11473841 REVERSE LENGTH=2554 | 5.0e-15 | 66% |
| RefSeq | Arabidopsis thaliana | NP_180257.3 | DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | 6.0e-15 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A9SRI0
Fln msg: Distance to subject end: 490 aas, your sequence is shorter than subject: 60 - 2591
Fln protein:
E
Protein Length:
61
Fln nts:
G
Fln Alignment:
GD4IA4402DN1GH___EQLIPLFECLVDTSASSGEVPQLCLNVLSRLTTYAPCVEAMVADRESXXXXXXXXHCAPS
A9SRI0_______________ERLSPLLSCLLDTGASSEHVPELCLNVLARLTMQASCVEALVADRSALLLLLQLLYCAPA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta