UniGene Name: sp_v3.0_unigene77095
Length: 127 nt
![]() |
---|
>sp_v3.0_unigene77095
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Fructose-bisphosphate aldolase, class I (IC) n=1 Tax=Ostreococcus tauri RepID=Q01GD0_OSTTA | - | - | 1.0e-11 | 78% |
FL-Next | sp=Fructose-bisphosphate aldolase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
Sma3 | Fructose-bisphosphate aldolase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase. | EC:4.1.2.13 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Pentose phosphate pathway | 00030 | 0.0 | % | |
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ALDCHL; ALDO; ALDP; AT2G21330; AlDP; AldP1; Aldp; At2g01140; At2g21330; At4g38970; CHLREDRAFT_152892; CHLREDRAFT_24459; F10A8.2; F19H22.70; F3K23.9; FBA1; FBA2; FBA3; FBAI; FbaC5; GSVIVT00030426001; GSVIVT00035963001; GSVIVT00036826001; LOC_Os11g07020; LO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | plastoglobule | GO:0010287 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | fructose-bisphosphate aldolase activity | GO:0004332 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase, class-I | IPR000741 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G01140.1 | Aldolase superfamily protein chr2:95006-96491 REVERSE LENGTH=391 | 2.0e-13 | 71% |
RefSeq | Arabidopsis thaliana | NP_001031386.1 | fructose-bisphosphate aldolase, class I [Arabidopsis thaliana] | 1.0e-13 | 73% |
RefSeq | Populus trichocarpa | XP_002311480.1 | predicted protein [Populus trichocarpa] | 3.0e-14 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NX65
Fln msg: Distance to subject end: 250 aas, your sequence is shorter than subject: 42 - 393
Fln protein:
G
Protein Length:
43
Fln nts:
T
Fln Alignment:
GD4IA4402EZVJE___GLGEYISGAILFEETLYQSCQDGTSFEDKLNQQGIVPGIKVD
A9NX65_______________GLGEYISGSILFEETLYQSTTDGRKFVDCLREQNIMPGIKVD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain