SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene77095

Length: 127 nt

UniGene Fasta

>sp_v3.0_unigene77095
TGGCCTTGGAGAGTACATCTCTGGCGCTATCCTTTTCGAGGAGACATTGTACCAGAGCTGCCAGGACGGAACCTCATTTGNGGATAAGCTCAACCAGCAGGGCATTGTCCCAGGTATCAAGGTTGAC

Ace file of the UniGene sp_v3.0_unigene77095

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Fructose-bisphosphate aldolase, class I (IC) n=1 Tax=Ostreococcus tauri RepID=Q01GD0_OSTTA	-	-	1.0e-11	78%
FL-Next	sp=Fructose-bisphosphate aldolase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	73%
Sma3	Fructose-bisphosphate aldolase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Fructose-bisphosphate aldolase.	EC:4.1.2.13	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Pentose phosphate pathway	00030	%
Sma3	Fructose and mannose metabolism	00051	%
Sma3	Methane metabolism	00680	%
Sma3	Carbon fixation in photosynthetic organisms	00710	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	ALDCHL; ALDO; ALDP; AT2G21330; AlDP; AldP1; Aldp; At2g01140; At2g21330; At4g38970; CHLREDRAFT_152892; CHLREDRAFT_24459; F10A8.2; F19H22.70; F3K23.9; FBA1; FBA2; FBA3; FBAI; FbaC5; GSVIVT00030426001; GSVIVT00035963001; GSVIVT00036826001; LOC_Os11g07020; LO

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	plastoglobule	GO:0010287	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	thylakoid lumen	GO:0031977	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	fructose-bisphosphate aldolase activity	GO:0004332	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Fructose-bisphosphate aldolase, class-I	IPR000741	-	-
Sma3	Double-stranded RNA-binding	IPR001159	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Helicase-associated domain	IPR007502	-	-
Sma3	DNA/RNA helicase, DEAD/DEAH box type, N-terminal	IPR011545	-	-
Sma3	Domain of unknown function DUF1605	IPR011709	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3		IPR014021	-	-
Sma3	Double-stranded RNA-binding-like	IPR014720	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G01140.1	Aldolase superfamily protein chr2:95006-96491 REVERSE LENGTH=391	2.0e-13	71%
RefSeq	Arabidopsis thaliana	NP_001031386.1	fructose-bisphosphate aldolase, class I [Arabidopsis thaliana]	1.0e-13	73%
RefSeq	Populus trichocarpa	XP_002311480.1	predicted protein [Populus trichocarpa]	3.0e-14	76%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NX65

Fln msg: Distance to subject end: 250 aas, your sequence is shorter than subject: 42 - 393

Fln protein: GLGEYISGAILFEETLYQSCQDGTSFEDKLNQQGIVPGIKVD

Protein Length: 43

Fln nts: TGGCCTTGGAGAGTACATCTCTGGCGCTATCCTTTTCGAGGAGACATTGTACCAGAGCTGCCAGGACGGAACCTCATTTGaGGATAAGCTCAACCAGCAGGGCATTGTCCCAGGTATCAAGGTTGAC

Fln Alignment:

GD4IA4402EZVJE___GLGEYISGAILFEETLYQSCQDGTSFEDKLNQQGIVPGIKVD
A9NX65_______________GLGEYISGSILFEETLYQSTTDGRKFVDCLREQNIMPGIKVD

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain