|
||||||
|
UniGene Name: sp_v3.0_unigene76943
Length: 247 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene76943
T |
|
Ace file of the UniGene sp_v3.0_unigene76943 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pericarp peroxidase 3 n=2 Tax=Sapindaceae RepID=B6E1W9_LITCN | - | - | 3.0e-28 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
| Sma3 | Peroxidase | - | - | 5.945e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 2.689e-25 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 2.689e-25 | % | |
| Sma3 | Methane metabolism | 00680 | 2.689e-25 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 2.689e-25 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.689e-25 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.689e-25 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.689e-25 | % |
| Source | Gene names |
|---|---|
| Sma3 | AP22.54; AoPOX1; At1g44970; At2g18140; At2g18150; At3g50990; At4g36430; At5g66390; C7A10.930; DIDI 6G-3B; F24M12.30; F27F5.6; F8D23.7; F8D23.8; GSVIVT00014550001; GSVIVT00036874001; K1F13.4; K1L20.16; OSIGBa0076I14.7; OSJNBa0035I04.3; OSJNBa0065J17.14; OS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G36430.1 | Peroxidase superfamily protein chr4:17204648-17205917 REVERSE LENGTH=331 | 8.0e-33 | 67% |
| RefSeq | Arabidopsis thaliana | NP_195361.1 | peroxidase 49 [Arabidopsis thaliana] | 1.0e-32 | 67% |
| RefSeq | Populus trichocarpa | XP_002310274.1 | predicted protein [Populus trichocarpa] | 4.0e-36 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPA0
Fln msg: Distance to subject end: 90 aas, your sequence is shorter than subject: 82 - 344
Fln protein:
G
Protein Length:
83
Fln nts:
T
Fln Alignment:
GD4IA4402DFT4C___GSNNNIPAPNSTLQTLITKFKLHGLNEVDLVALSGGHTIGQSRCANFRQRLYDQSGNDQPDITLEKSFLGRLISMCPKSGGD
B8LPA0_______________GSNNNIPAPNSTLQTLTTKFNLQGLNEVDLVALSGSHTIGLSRCTSFRQRLYNQSGNGQPDFTLDKSYATQLKSGCPKSGGD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
