UniGene Name: sp_v3.0_unigene76589
Length: 236 nt
![]() |
---|
>sp_v3.0_unigene76589
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Multidrug resistance-associated protein 2, 6 (Mrp2, 6), abc-transoprter, putative (Fragment) n=1 Tax=Ricinus communis RepID=B9T8Y6_RICCO | - | - | 1.0e-22 | 84% |
FL-Next | sp=Probable non-intrinsic ABC protein 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 79% |
Sma3 | Multidrug resistance protein ABC transporter family | - | - | 2.24208e-44 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.122e-08 | - |
Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.531e-28 | - |
Source | Gene names |
---|---|
Sma3 | At1g04120; At1g71330; At2g47800; At3g13080; At3g13090; At3g13100; At3g21250; At3g59140; At3g60160; At3g60970; At3g62700; B1065G12.13; B1157F09.14; CHLREDRAFT_143900; EST2; EST3; F17A22.19; F17J16.190; F20D22.11; F26K9.130; F3I17.2; FeMRP3; GSVIVT000024760 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
Sma3 | folic acid transporter activity | GO:0008517 | Molecular Function | 0.0 | - |
Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G71330.1 | ATNAP5, NAP5 non-intrinsic ABC protein 5 chr1:26884014-26885169 REVERSE LENGTH=324 | 1.0e-26 | 79% |
RefSeq | Arabidopsis thaliana | NP_177289.1 | putative non-intrinsic ABC protein 5 [Arabidopsis thaliana] | 2.0e-26 | 79% |
RefSeq | Populus trichocarpa | XP_002321253.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 3.0e-27 | 81% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FVV9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 197 aas, your sequence is shorter than subject: 71 - 324
Fln protein:
A
Protein Length:
72
Fln nts:
G
Fln Alignment:
GD4IA4402C0QNY___ALYQDADIYLLDDPFSAVDAHTGTHLFQECLMGVLSGKTLIYVTHQVDFLPSADLILVM
Q9FVV9_______________ALYQDADIYLFDDPFSAVDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain