UniGene Name: sp_v3.0_unigene76053
Length: 226 nt
UniGene Fasta |
---|
>sp_v3.0_unigene76053
C |
Ace file of the UniGene sp_v3.0_unigene76053 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative serine/threonine-protein kinase WNK6 [Arabidopsis thaliana] ref|NP_001189928.1| putative serine/threonine-protein kinase WNK6 [Arabidopsis thaliana] sp|Q8S8Y8.1|WNK6_ARATH RecName: Full=Probable serine/threonine-protein kinase WNK6; Short=AtWNK6; | - | - | 2.0e-14 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Kinase, putative | - | - | 1.083e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 5.267e-13 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 2.887e-18 | - |
Source | Gene names |
---|---|
Sma3 | AT1G49160; At1g49160; At1g64630; At3g04910; At3g18750; At3g48260; GSVIVT00000541001; GSVIVT00006916001; GSVIVT00008654001; GSVIVT00015972001; GSVIVT00023951001; GSVIVT00034861001; LOC_Os02g45130; MEK1; MVE11.20; OJ1197_E09.9; Os02g0672800; OsI_025649; OsI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | circadian rhythm | GO:0007623 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G18750.1 | WNK6, ZIK5, ATWNK6 with no lysine (K) kinase 6 chr3:6454307-6456830 REVERSE LENGTH=567 | 4.0e-19 | 69% |
RefSeq | Arabidopsis thaliana | NP_001189928.1 | putative serine/threonine-protein kinase WNK6 [Arabidopsis thaliana] | 5.0e-19 | 69% |
RefSeq | Populus trichocarpa | XP_002318673.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSG2
Fln msg: Distance to subject end: 581 aas, your sequence is shorter than subject: 75 - 885
Fln protein:
C
Protein Length:
76
Fln nts:
C
Fln Alignment:
GD4IA4402EDIQ7___QIYRKVTSGIKPAALNKIKDPQTKAFIEKCLVAAPQRLPAKELLLDPFLQCDGH
C0PSG2_______________QIYKKVTSGKKPAALYKVKDPEVRQFVEKCLVTVSRRLPARELLMDPFLQTDEH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain