UniGene Name: sp_v3.0_unigene75993
Length: 170 nt
UniGene Fasta |
---|
>sp_v3.0_unigene75993
G |
Ace file of the UniGene sp_v3.0_unigene75993 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Carbohydrate binding protein, putative n=1 Tax=Ricinus communis RepID=B9SPL3_RICCO | - | - | 2.0e-14 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Putative receptor-type protein kinase LRK1 | - | - | 3.811e-17 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 8.772e-06 | - |
Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 2.158e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT4g04960; At1g15530; At2g37710; At3g45440; At4g04960; At5g59260; B1008E06.18; F9K21.20; GSVIVT00001297001; GSVIVT00005374001; GSVIVT00015995001; GSVIVT00018441001; GSVIVT00018594001; GSVIVT00021359001; GSVIVT00024271001; GSVIVT00029340001; GSVIVT00029342 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | IPR001899 | - | 0.0 | - | |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Ribosomal protein L10, eubacterial, conserved site | IPR002363 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15530.1 | Concanavalin A-like lectin protein kinase family protein chr1:5339961-5341931 REVERSE LENGTH=656 | 2.0e-19 | 62% |
RefSeq | Arabidopsis thaliana | NP_173006.1 | concanavalin A-like lectin protein kinase-like protein [Arabidopsis thaliana] | 3.0e-19 | 62% |
RefSeq | Populus trichocarpa | XP_002322198.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-19 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ6
Fln msg: Distance to subject end: 290 aas, your sequence is shorter than subject: 56 - 704
Fln protein:
G
Protein Length:
57
Fln nts:
G
Fln Alignment:
GD4IA4402EI8SM___GFGKVYKGVLPSSGQEVAVKCITKEFTEGMKAFVAEISSMGRLQHRNLVHLRGWCR
B8LLJ6_______________GFGKVYKGVLPSSGQEVAVKCITKEFTEGMKGFVAEISSMGRLQHRNLVQLRGWCR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain