|
||||||
|
UniGene Name: sp_v3.0_unigene75492
Length: 181 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene75492
G |
|
Ace file of the UniGene sp_v3.0_unigene75492
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative serine/threonine kinase [Manihot esculenta] | - | - | 4.0e-15 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | ATP binding protein, putative | - | - | 1.498e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.824e-08 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 3.99e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G29720; AT1G53420; AT1G53440; AT3G14840; AT3G24550; At1g11050; At1g29720; At1g29730; At1g70450; At1g70530; At3g24550; At5g02800; At5g40380; B1065E10.29; CRK3; CRK42; F17O7.1; F1N18.20; F1N18.21; F1N18.22; F24J13.10; F24J13.2; F8K4.7; F9G14_110; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to plasma membrane | GO:0005887 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
| Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G53420.1 | Leucine-rich repeat transmembrane protein kinase chr1:19926626-19931494 REVERSE LENGTH=953 | 1.0e-18 | 68% |
| RefSeq | Arabidopsis thaliana | NP_175747.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 1.0e-18 | 68% |
| RefSeq | Populus trichocarpa | XP_002332242.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-20 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPW7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 131 aas, your sequence is shorter than subject: 59 - 702
Fln protein:
S
Protein Length:
60
Fln nts:
G
Fln Alignment:
GFIJCBT03GII37___FGEDQSHVSTRIAGTFGYMAPEYALCGQLTEKADVFSFGVVVLEIISGRR
C0PPW7_______________FAEDQSHVSTRVAGTLGYMAPEYALRGQLTEKADVFSFGVLVLEIISGRK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
