|
||||||
|
UniGene Name: sp_v3.0_unigene75347
Length: 160 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene75347
A |
|
Ace file of the UniGene sp_v3.0_unigene75347
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Lipoxygenase n=4 Tax=Vitis RepID=D5FUD8_VITVI | - | - | 2.0e-17 | 81% |
| FL-Next | sp=Lipoxygenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Lipoxygenase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lipoxygenase. | EC:1.13.11.12 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Linoleic acid metabolism | 00591 | 0.0 | % | |
| Sma3 | alpha-Linolenic acid metabolism | 00592 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g17420; At1g72520; At3g45140; B1168A08.24; B1168A08.28-1; B1168A08.28-2; CM-LOX1; CM-LOX2; F28G4.10; F28P22.29; GSVIVT00008869001; GSVIVT00008870001; GSVIVT00013069001; GSVIVT00013309001; GSVIVT00019960001; GSVIVT00022800001; GSVIVT00022801001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | lipoxygenase activity | GO:0016165 | Molecular Function | 0.0 | - |
| Sma3 | phytoene dehydrogenase activity | GO:0016166 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid biosynthetic process | GO:0009695 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | Lipoxygenase | IPR000907 | - | 0.0 | - |
| Sma3 | Lipoxygenase, LH2 | IPR001024 | - | 0.0 | - |
| Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
| Sma3 | Lipoxygenase, plant | IPR001246 | - | 0.0 | - |
| Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, conserved site | IPR018483 | - | 0.0 | - |
| Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G45140.1 | LOX2, ATLOX2 lipoxygenase 2 chr3:16525437-16529233 FORWARD LENGTH=896 | 2.0e-19 | 68% |
| RefSeq | Arabidopsis thaliana | NP_566875.1 | lipoxygenase 2 [Arabidopsis thaliana] | 3.0e-19 | 68% |
| RefSeq | Populus trichocarpa | XP_002297796.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 82% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM20
Fln msg: Distance to subject end: 587 aas, your sequence is shorter than subject: 53 - 883
Fln protein:
W
Protein Length:
54
Fln nts:
A
Fln Alignment:
GFIJCBT03GGSZ6___KAYDRIYDYDVYNDIGNPDSNPELLRPVLGGSKDYPYPRRCRTGRPPCKT
B8LM20_______________KVSDRIYDYDVYNDLGDPDSDPELVRKVLGGSKDFPYPRRCRTGRSPTQT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
