SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene74865

Length: 393 nt

UniGene Fasta

>sp_v3.0_unigene74865
ATAACAGTCTTGACAAGCATTTGTTCGGAAAGATACGAAATGTTTTGAGTTGGGAAAATCGTTTAAAGATTATAGTGGGCACAGCACGAGGACTCGCATATCTACACGAGGATTCCAATATGAGAATTATACACAGAGATATCAAATGTGGCAATATACTTCTAAATGACAGATTTCATCCTAAAATAGCAGATTTCGGAATGGCTCGATTCTTTACAGAAGGTGATACCAATGTTTCGAAAAACATGGCAGGAACAATAGGCTACATTGCGCCTGAGTATGCAGTCCACGGACAATTAACGGAAAAAGCTGACGTTTATAGCTACGGTATTGTGGTTCTTGAGATCGTCAGTGGGAGAAAGGCTGTGGATGCAAGATTGGATGCCACTATGC

Ace file of the UniGene sp_v3.0_unigene74865

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	putative receptor-like protein kinase [Oryza sativa Japonica Group]	-	-	5.0e-40	61%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	83%
Sma3	ATP binding protein, putative	-	-	1.916e-14	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific protein-tyrosine kinase.	EC:2.7.10.2	-	2.457e-13	-
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	5.746e-07	-
Sma3		EC:2.7.11.3-	-	3.659e-13	-

Source	Gene names
Sma3	24K23.9; AT1G53420; AT3G24550; At1g49270; At1g52290; At1g68690; At1g70460; At1g70520; At1g70530; At2g20300; At2g48010; At4g34440; At4g34440/T4L20_20; At5g38560; At5g40380; CRK2; CRK3; CRK42; F13F21.28; F14G9.24; F19K6.9; F24J13.10; F24J13.3; F24J13.9; F24

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to plasma membrane	GO:0005887	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	structural constituent of cell wall	GO:0005199	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	protoderm histogenesis	GO:0010068	Biological Process	-
Sma3	cuticle development	GO:0042335	Biological Process	-
Sma3	shoot development	GO:0048367	Biological Process	-
Sma3	organ formation	GO:0048645	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Transcription factor, MADS-box	IPR002100	-	-
Sma3	Chaperonin TCP-1, conserved site	IPR002194	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Glycoprotein D/GG/GX, Herpesvirus	IPR002896	-	-
Sma3	Gnk2-homologous domain	IPR002902	-	-
Sma3	Pistil-specific extensin-like protein	IPR003882	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-
Sma3	Heat shock protein DnaJ, conserved site	IPR018253	-	-
Sma3	Dil domain	IPR018444	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G24550.1	ATPERK1, PERK1 proline extensin-like receptor kinase 1 chr3:8960411-8963303 FORWARD LENGTH=652	9.94922e-44	54%
RefSeq	Arabidopsis thaliana	NP_189098.1	proline extensin-like receptor kinase 1 [Arabidopsis thaliana]	2.00386e-43	54%
RefSeq	Populus trichocarpa	XP_002298473.1	predicted protein, partial [Populus trichocarpa]	0.0	59%

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LLL8

Fln msg: Distance to subject end: 112 aas, atg_distance in limit (1-15): atg_distance = 4, W2: There is no M at the beginning, your sequence is shorter than subject: 130 - 245

Fln protein: NSLDKHLFGKIRNVLSWENRLKIIVGTARGLAYLHEDSNMRIIHRDIKCGNILLNDRFHPKIADFGMARFFTEGDTNVSKNMAGTIGYIAPEYAVHGQLTEKADVYSYGIVVLEIVSGRKAVDARLDATM

Protein Length: 131

Fln nts: ATAACAGTCTTGACAAGCATTTGTTCGGAAAGATACGAAATGTTTTGAGTTGGGAAAATCGTTTAAAGATTATAGTGGGCACAGCACGAGGACTCGCATATCTACACGAGGATTCCAATATGAGAATTATACACAGAGATATCAAATGTGGCAATATACTTCTAAATGACAGATTTCATCCTAAAATAGCAGATTTCGGAATGGCTCGATTCTTTACAGAAGGTGATACCAATGTTTCGAAAAACATGGCAGGAACAATAGGCTACATTGCGCCTGAGTATGCAGTCCACGGACAATTAACGGAAAAAGCTGACGTTTATAGCTACGGTATTGTGGTTCTTGAGATCGTCAGTGGGAGAAAGGCTGTGGATGCAAGATTGGATGCCACTATGC

Fln Alignment:

GFIJCBT03HF8BH___NSLDKHLFGKIRNVLSWENRLKIIVGTARGLAYLHEDSNMRIIHRDIKCGNILLNDRFHPKIADFGMARFFTEGDTNVSKNMAGTIGYIAPEYAVHGQLTEKADVYSYGIVVLEIVSGRKAVDARLDATM
B8LLL8_______________NSLHKHLFGEIQNVLSWEKRLGIIVGTARGLTYLHEDSNVRIIHRDIKCGNILLDDRFHPKIADFGLARFFPDGETHVSTRVGGTIGYTAPEYAVHGQLTEKADVYSYGIVVLEIVSGRKSVNARLDASM

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain