|
||||||
|
UniGene Name: sp_v3.0_unigene74619
Length: 206 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene74619
C |
|
Ace file of the UniGene sp_v3.0_unigene74619
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Type A response regulator n=1 Tax=Selaginella moellendorffii RepID=D8SLQ9_SELML | - | - | 5.0e-18 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Type-a response regulator | - | - | 1.459e-34 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARR15; ARR16; ARR17; ARR3; ARR4; ARR5; ARR6; ARR7; ARR8; ARR9; ATRR1; ATRR2; ATRR3; ATRR4; At1g10470; At1g19050; At1g59940; At1g74890; At2g40670; At2g41310; At3g48100; At3g56380; At3g57040; At5g62920; B1250G12.17; F13H10.14; F14D16.20; F23H11.25; F24I3.12 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | two-component response regulator activity | GO:0000156 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | circadian rhythm | GO:0007623 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | cytokinin mediated signaling pathway | GO:0009736 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
| Sma3 | response to red light | GO:0010114 | Biological Process | 0.0 | - |
| Sma3 | red light signaling pathway | GO:0010161 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | stem cell maintenance | GO:0019827 | Biological Process | 0.0 | - |
| Sma3 | regulation of circadian rhythm | GO:0042752 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytosolic fatty-acid binding | IPR000463 | - | 0.0 | - |
| Sma3 | Signal transduction response regulator, receiver domain | IPR001789 | - | 0.0 | - |
| Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G56380.1 | ARR17, RR17 response regulator 17 chr3:20905480-20906368 FORWARD LENGTH=153 | 5.0e-25 | 67% |
| RefSeq | Arabidopsis thaliana | NP_567037.1 | two-component response regulator ARR17 [Arabidopsis thaliana] | 6.0e-25 | 67% |
| RefSeq | Populus trichocarpa | XP_002325489.1 | type-a response regulator [Populus trichocarpa] | 6.0e-25 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWL1
Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 68 - 208
Fln protein:
H
Protein Length:
69
Fln nts:
C
Fln Alignment:
GFIJCBT03FNSM4___HEEQSTCATTNVKAFKVNMIITDYCMPGMTGYDLLKKVKETKCLKEIPVVIISSENVPQRITSCLAEG
A9NWL1_______________HEEQSTCAASN--AFKVNMIITDYCMPGMTGYDLLKKVQETKCLKEIPVVIISSENVPQRITSCLAGG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
