|
||||||
|
UniGene Name: sp_v3.0_unigene74571
Length: 170 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene74571
G |
|
Ace file of the UniGene sp_v3.0_unigene74571
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Beta-glucosidase 6 n=3 Tax=Oryza sativa RepID=BGL06_ORYSJ | - | - | 2.0e-17 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Beta-glucosidase | - | - | 1.367e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Beta-glucosidase. | EC:3.2.1.21 | - | 5.672e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyanoamino acid metabolism | 00460 | 5.672e-16 | % | |
| Sma3 | Starch and sucrose metabolism | 00500 | 5.672e-16 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 5.672e-16 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 5.672e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | AH1; AT3G18080; At1g26560; At1g75940; At2g44460; At3g18070; At3g18080; At3g60120; At3g60140; At5g24540; At5g36890; BGLU1; GSVIVT00003779001; GSVIVT00003784001; GSVIVT00003787001; GSVIVT00003795001; GSVIVT00003796001; GSVIVT00003800001; GSVIVT00004181001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | beta-glucosidase activity | GO:0008422 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | amygdalin beta-glucosidase activity | GO:0047668 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, beta-glucosidase | IPR017736 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G26560.1 | BGLU40 beta glucosidase 40 chr1:9178513-9181726 FORWARD LENGTH=510 | 7.0e-22 | 77% |
| RefSeq | Arabidopsis thaliana | NP_173978.1 | beta glucosidase 40 [Arabidopsis thaliana] | 9.0e-22 | 77% |
| RefSeq | Populus trichocarpa | XP_002316096.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-23 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PT85
Fln msg: your sequence is shorter than subject: 49 - 508
Fln protein:
Y
Protein Length:
50
Fln nts:
G
Fln Alignment:
GFIJCBT03HAKOE___YFAWSLLDNWEWAAGYTSRFGLYFVDYRHNLTRHPKASVQWFKCFL
C0PT85_______________YFAWSLIDNFEWSQGYTKRFGLVFVDYKNELKRHPKSSAHWFTSFL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
