UniGene Name: sp_v3.0_unigene74546
Length: 199 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene74546
G |
Ace file of the UniGene sp_v3.0_unigene74546 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Xanthine dehydrogenase (Fragment) n=1 Tax=Picea abies RepID=F1LJN0_PICAB | - | - | 2.0e-27 | 92% |
FL-Next | sp=Xanthine dehydrogenase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
Sma3 | Xanthine dehydrogenase | - | - | 5.671e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferred entry: 1.17.1.4. | EC:1.1.1.204 | - | 2.836e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT4g34890; AT4g34900; At4g34890; At4g34900; At4g34900/F11I11_140; CHLREDRAFT_117669; GSVIVT00024622001; LOC_Os03g31550; MICPUN_83794; OSJNBa0091B22.11; Os03g0429800; OsI_12147; OsJ_11360; POPTRDRAFT_804467; RCOM_1577610; T11I11.130; T11I11.140; VITISV_013 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | xanthine dehydrogenase activity | GO:0004854 | Molecular Function | 0.0 | - |
Sma3 | xanthine oxidase activity | GO:0004855 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
Sma3 | purine base catabolic process | GO:0006145 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead | IPR000674 | - | 0.0 | - |
Sma3 | 2Fe-2S ferredoxin-type domain | IPR001041 | - | 0.0 | - |
Sma3 | Molybdopterin dehydrogenase, FAD-binding | IPR002346 | - | 0.0 | - |
Sma3 | [2Fe-2S]-binding | IPR002888 | - | 0.0 | - |
Sma3 | CO dehydrogenase flavoprotein, C-terminal | IPR005107 | - | 0.0 | - |
Sma3 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR006058 | - | 0.0 | - |
Sma3 | Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding | IPR008274 | - | 0.0 | - |
Sma3 | Beta-grasp domain | IPR012675 | - | 0.0 | - |
Sma3 | Xanthine dehydrogenase, small subunit | IPR014307 | - | 0.0 | - |
Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
Sma3 | FAD-binding, type 2, subdomain 1 | IPR016167 | - | 0.0 | - |
Sma3 | CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 | IPR016169 | - | 0.0 | - |
Sma3 | Aldehyde oxidase/xanthine dehydrogenase | IPR016208 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G34900.1 | ATXDH2, XDH2 xanthine dehydrogenase 2 chr4:16625688-16631306 REVERSE LENGTH=1353 | 2.0e-27 | 72% |
RefSeq | Arabidopsis thaliana | NP_195216.2 | xanthine dehydrogenase 2 [Arabidopsis thaliana] | 3.0e-27 | 72% |
RefSeq | Populus trichocarpa | XP_002314067.1 | xanthine dehydrogenase [Populus trichocarpa] | 1.0e-26 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: F4JLI5
Fln msg: Distance to subject end: 953 aas, your sequence is shorter than subject: 65 - 1353
Fln protein:
I
Protein Length:
66
Fln nts:
G
Fln Alignment:
GFIJCBT03GCBUN___IAQRDAHEASACSSFVEQGLRWFAGTQIRNFASVGGNICTASPISDLNPLWMAARAQFNIIDCKG
F4JLI5_______________VKERPAHETSACKAFIEQ-LKWFAGTQIRNVACIGGNICTASPISDLNPLWMASRAEFRIINCNG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain