UniGene Name: sp_v3.0_unigene74488
Length: 229 nt
![]() |
---|
>sp_v3.0_unigene74488
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alpha-glucan water dikinase 1 [Arabidopsis thaliana] sp|Q9SAC6.2|GWD1_ARATH RecName: Full=Alpha-glucan water dikinase 1, chloroplastic; AltName: Full=Protein starch excess 1; AltName: Full=Protein starch-related R1; Flags: Precursor gb|AAG47821.1|AF312027 | - | - | 4.0e-08 | 68% |
FL-Next | sp=Alpha-glucan water dikinase 1, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 68% |
Sma3 | Alpha-glucan water dikinase, chloroplastic | - | - | 2.9e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histidine kinase. | EC:2.7.13.3 | - | 4.298e-06 | - |
Sma3 | Alpha-glucan, water dikinase. | EC:2.7.9.4 | - | 1.294e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g10760; GSVIVT00002767001; GWD; GWD1; Os06g0498400; OsI_23085; OsJ_21446; PHYPADRAFT_174645; POPTRDRAFT_1089922; R1; RCOM_0024100; SEX1; T16B5.10; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
Sma3 | alpha-glucan, water dikinase activity | GO:0050521 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | phosphorylation | GO:0016310 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PEP-utilising enzyme, C-terminal | IPR000121 | - | 0.0 | - |
Sma3 | Pyruvate phosphate dikinase, PEP/pyruvate-binding | IPR002192 | - | 0.0 | - |
Sma3 | Pectinesterase inhibitor | IPR006501 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 1 | IPR013815 | - | 0.0 | - |
Sma3 | PEP-utilising enzyme, active site | IPR018274 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G10760.1 | SEX1, SOP1, SOP, GWD1, GWD Pyruvate phosphate dikinase, PEP/pyruvate binding domain chr1:3581210-3590043 REVERSE LENGTH=1399 | 1.0e-11 | 68% |
RefSeq | Arabidopsis thaliana | NP_563877.1 | alpha-glucan water dikinase 1 [Arabidopsis thaliana] | 2.0e-11 | 68% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SAC6
Fln msg: Distance to subject end: 407 aas, your sequence is shorter than subject: 75 - 1399
Fln protein:
A
Protein Length:
76
Fln nts:
G
Fln Alignment:
GFIJCBT03HKT9T___NRLDPILRNIANLGHWQIISPVEVRGFVTIIDDLLRVQ
Q9SAC6_______________NRLDPVLRKTANLGSWQVISPVEVVGYVIVVDELLTVQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain