UniGene Name: sp_v3.0_unigene73282
Length: 227 nt
![]() |
---|
>sp_v3.0_unigene73282
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamyl alcohol dehydrogenase (Fragment) n=3 Tax=Pinaceae RepID=Q8S598_9CONI | - | - | 1.0e-26 | 94% |
FL-Next | tr=Cinnamyl-alcohol dehydrogenase; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 92% |
Sma3 | Cinnamyl alcohol dehydrogenase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 4.195e-28 | - |
Source | Gene names |
---|---|
Sma3 | AT2G21730; AT2G21890; AT4G39330; At1g72680; At2g21730; At2g21890; At3g19450; At4g34230; At4g39330; AtCAD1; BM1; CAD; CAD1; CAD14; CAD19; CAD2; CAD3; CAD4; CAD5; CAD6; CAD7; CAD8; CADL1; CADL10; CADL3; CADL4; CADL5; CADL6; CADL7; CADL8; CADL9; CADa; CADa-1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
Sma3 | cofactor binding | GO:0048037 | Molecular Function | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR017900 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G19450.1 | CAD4, ATCAD4, CAD, CAD-C GroES-like zinc-binding alcohol dehydrogenase family protein chr3:6744859-6747005 FORWARD LENGTH=365 | 2.0e-26 | 74% |
RefSeq | Arabidopsis thaliana | NP_188576.1 | cinnamyl alcohol dehydrogenase 4 [Arabidopsis thaliana] | 3.0e-26 | 74% |
RefSeq | Populus trichocarpa | XP_002313875.1 | cinnamyl alcohol dehydrogenase [Populus trichocarpa] | 3.0e-27 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q5NDD6
Fln msg: Distance to subject end: 104 aas, your sequence is shorter than subject: 75 - 357
Fln protein:
R
Protein Length:
76
Fln nts:
C
Fln Alignment:
GG46A6U02F90ZY___ILGLGGVGHMGVKIAKAFGLHVTVISSSAKKKEEALEVLGADAYLVSNDGEKMQEAAESLDFILDTI
Q5NDD6_______________ILGLGGVGHMGVKIAKAFGLHVTVISSSDKKKEEALEVLGADAYLVSKDAEKMQEAAESLDYIMDTI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain