|
||||||
|
UniGene Name: sp_v3.0_unigene73271
Length: 185 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene73271
C |
|
Ace file of the UniGene sp_v3.0_unigene73271
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 6-phosphofructokinase 2 [Arabidopsis thaliana] sp|Q9FIK0.1|K6PF2_ARATH RecName: Full=6-phosphofructokinase 2; AltName: Full=Phosphofructokinase 2; AltName: Full=Phosphohexokinase 2 dbj|BAB11328.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase-li | - | - | 3.0e-19 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Phosphofructokinase, putative | - | - | 1.515e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 6-phosphofructokinase. | EC:2.7.1.11 | - | 9.292e-36 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 9.292e-36 | % | |
| Sma3 | Pentose phosphate pathway | 00030 | 9.292e-36 | % | |
| Sma3 | Fructose and mannose metabolism | 00051 | 9.292e-36 | % | |
| Sma3 | Galactose metabolism | 00052 | 9.292e-36 | % | |
| Sma3 | Methane metabolism | 00680 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 9.292e-36 | % | |
| Sma3 | Metabolic pathways | 01100 | 9.292e-36 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.292e-36 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g22480; At4g26270; At4g29220; At4g32840; At5g47810; At5g56630; At5g61580; F14M13.12; F17A13.40; GSVIVT00013096001; GSVIVT00014270001; GSVIVT00016633001; GSVIVT00032133001; K11J9.3; MCA23.13; MICPUCDRAFT_53485; MICPUN_63659; MIK19.8; OJ1593_C11.1; OSIGB |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | 6-phosphofructokinase complex | GO:0005945 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | 6-phosphofructokinase activity | GO:0003872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphofructokinase domain | IPR000023 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
| Sma3 | Pyrophosphate-dependent phosphofructokinase TP0108 | IPR012004 | - | 0.0 | - |
| Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G47810.1 | PFK2 phosphofructokinase 2 chr5:19356569-19357989 REVERSE LENGTH=444 | 2.0e-25 | 81% |
| RefSeq | Arabidopsis thaliana | NP_199592.1 | 6-phosphofructokinase 2 [Arabidopsis thaliana] | 3.0e-25 | 81% |
| RefSeq | Populus trichocarpa | XP_002329965.1 | predicted protein [Populus trichocarpa] | 9.0e-25 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PT73
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 43 aas, your sequence is shorter than subject: 61 - 426
Fln protein:
S
Protein Length:
62
Fln nts:
C
Fln Alignment:
GG46A6U02IJON5___FTLKYIDPTYMIRAVPANAADSIYCTLLAHSAIHGAMAGYTGFAAGMINGIYA
C0PT73_______________FTLKYIDPTYMIRAVPGNAADNIYCTLLAHSAIHGVMAGYTGFAAGMINGVYA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
