UniGene Name: sp_v3.0_unigene73252
Length: 221 nt
![]() |
---|
>sp_v3.0_unigene73252
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Beta-galactosidase n=2 Tax=Solanum lycopersicum RepID=E3UVW8_SOLLC | - | - | 2.0e-14 | 62% |
FL-Next | sp=Beta-galactosidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Beta-galactosidase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-galactosidase. | EC:3.2.1.23 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Galactose metabolism | 00052 | 0.0 | % | |
Sma3 | Other glycan degradation | 00511 | 0.0 | % | |
Sma3 | Glycosaminoglycan degradation | 00531 | 0.0 | % | |
Sma3 | Sphingolipid metabolism | 00600 | 0.0 | % | |
Sma3 | Glycosphingolipid biosynthesis - ganglio series | 00604 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At2g28470; BGAL8; GAL1; GAL3; GSVIVT00010093001; GSVIVT00014538001; GSVIVT00016563001; GSVIVT00019299001; GSVIVT00024515001; GSVIVT00035924001; GSVIVT00036860001; LOC_Os01g65460; LOC_Os03g06940; OJ1123F12.1; Os01g0875500; Os03g0165400; OsI_04635; OsI_1015 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | beta-galactosidase complex | GO:0009341 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | beta-galactosidase activity | GO:0004565 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | D-galactoside/L-rhamnose binding SUEL lectin domain | IPR000922 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 35 | IPR001944 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 2, N-terminal | IPR006104 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G28470.1 | BGAL8 beta-galactosidase 8 chr2:12169047-12173164 REVERSE LENGTH=852 | 1.0e-16 | 68% |
RefSeq | Arabidopsis thaliana | NP_001189624.1 | beta-galactosidase 8 [Arabidopsis thaliana] | 1.0e-16 | 68% |
RefSeq | Populus trichocarpa | XP_002305449.1 | predicted protein [Populus trichocarpa] | 8.0e-19 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUR2
Fln msg: Distance to subject end: 417 aas, your sequence is shorter than subject: 73 - 861
Fln protein:
R
Protein Length:
74
Fln nts:
C
Fln Alignment:
GG46A6U02GEEZK___CHSFLSNTGIKQAATVQFNGNSYQLPAWSVSILPDCKNVVFNTAKVSVQTSLMGM
A9NUR2_______________CAAFLANSNTQSDATVKFNGNSYHLPAWSVSILPDCKNVVFNTAKIGSQTTSVQM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain