|
||||||
|
UniGene Name: sp_v3.0_unigene72942
Length: 177 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72942
C |
|
Ace file of the UniGene sp_v3.0_unigene72942
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dihydroorotate dehydrogenase (quinone), mitochondrial n=3 Tax=Arabidopsis RepID=PYRD_ARATH | - | - | 2.0e-17 | 86% |
| FL-Next | sp=Dihydroorotate dehydrogenase (quinone), mitochondrial; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 86% |
| Sma3 | Dihydroorotate dehydrogenase | - | - | 1.735e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydroorotate oxidase. | EC:1.3.3.1 | - | 3.58e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyrimidine metabolism | 00240 | 3.58e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.58e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | At5g23300; CHLREDRAFT_152239; GSVIVT00007090001; H0101F08.3; H0103C06.13; MICPUCDRAFT_44893; MICPUN_64581; MKD15.16; OSJNBa0064G10.3; OSTLU_13090; Os04g0676300; OsI_17913; OsJ_16613; Ot12g00230; PHYPADRAFT_197321; PHYPADRAFT_70715; POPTRDRAFT_218098; POPT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | dihydroorotate dehydrogenase activity | GO:0004152 | Molecular Function | 0.0 | - |
| Sma3 | dihydroorotate oxidase activity | GO:0004158 | Molecular Function | 0.0 | - |
| Sma3 | 'de novo' pyrimidine base biosynthetic process | GO:0006207 | Biological Process | 0.0 | - |
| Sma3 | UMP biosynthetic process | GO:0006222 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydroorotate dehydrogenase, conserved site | IPR001295 | - | 0.0 | - |
| Sma3 | Dihydroorotate dehydrogenase, class 2 | IPR005719 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Dihydroorotate dehydrogenase, class 1/ 2 | IPR012135 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G23300.1 | PYRD pyrimidine d chr5:7847792-7850243 REVERSE LENGTH=460 | 2.0e-23 | 86% |
| RefSeq | Arabidopsis thaliana | NP_568428.1 | dihydroorotate dehydrogenase [Arabidopsis thaliana] | 3.0e-23 | 86% |
| RefSeq | Populus trichocarpa | XP_002310061.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-22 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P32746
Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 58 - 460
Fln protein:
V
Protein Length:
59
Fln nts:
C
Fln Alignment:
GG46A6U02ITBXH___LSTNTLREMYQLTRGRITLIGCGGISSGEDAYKKIRAGATLVQLYTGFSY
P32746_______________LSTNMLRDMYTLTRGKIPLIGCGGVSSGEDAYKKIRAGATLVQLYTGFAY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
