|
||||||
|
UniGene Name: sp_v3.0_unigene72791
Length: 156 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72791
C |
|
Ace file of the UniGene sp_v3.0_unigene72791
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam03214, RGP, Reversibly glycosylated polypeptide | - | - | 3.0e-14 | 53% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | Alpha-1,4-glucan-protein synthase [UDP-forming], putative | - | - | 2.83e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.126e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g02230; At3g08900; At3g08900/T16O11_16; At5g15650; AtRGP; BA12; F14F8_30; F14P3.12; GRPL1; GRPL2; GSVIVT00000015001; GSVIVT00017950001; GSVIVT00030012001; GSVIVT00038072001; LOC_Os03g40270; OJ1523_A02.1; OSJNBb0040H10.21; Os03g0599800; Os07g0604800; Os |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | cell junction | GO:0030054 | Cellular Component | 0.0 | - |
| Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
| Sma3 | GO:0047210 | Molecular Function | 0.0 | - | |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alpha-1,4-glucan-protein synthase, UDP-forming | IPR004901 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G15650.1 | RGP2, ATRGP2 reversibly glycosylated polypeptide 2 chr5:5092203-5094093 FORWARD LENGTH=360 | 2.0e-20 | 75% |
| RefSeq | Arabidopsis thaliana | NP_197069.1 | reversibly glycosylated polypeptide 2 [Arabidopsis thaliana] | 3.0e-20 | 75% |
| RefSeq | Populus trichocarpa | XP_002305394.1 | predicted protein [Populus trichocarpa] | 3.0e-22 | 88% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NKS5
Fln msg: Distance to subject end: 18 aas, your sequence is shorter than subject: 52 - 363
Fln protein:
R
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02JBZT9___TSVQQCYIELSKQVREKLGVIDPYFQKLADAMVTWIEAWDELNP
A9NKS5_______________TSVQQCYIELSKQVKESLGKVDPYFQKLADAMVTWIEAWDELNP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
