|
||||||
|
UniGene Name: sp_v3.0_unigene72714
Length: 143 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72714
T |
|
Ace file of the UniGene sp_v3.0_unigene72714
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | sp=ADP-ribosylation factor GTPase-activating protein AGD3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 87% |
| Sma3 | Gcn4-complementing protein, putative | - | - | 1.455e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AGD1; AGD3; At5g13300; At5g61980; GSVIVT00006190001; GSVIVT00018033001; K22G18.9; Os08g0537600; Os09g0510700; OsI_30058; OsI_31998; OsJ_28103; OsJ_29976; P0665C04.28; PHYPADRAFT_72208; PHYPADRAFT_89004; PHYPADRAFT_93849; POPTRDRAFT_1066240; POPTRDRAFT_252 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | endosome | GO:0005768 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | trans-Golgi network transport vesicle | GO:0030140 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ARF GTPase activator activity | GO:0008060 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol binding | GO:0035091 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
| Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
| Sma3 | regulation of ARF GTPase activity | GO:0032312 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Arf GTPase activating protein | IPR001164 | - | 0.0 | - |
| Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | BAR domain | IPR004148 | - | 0.0 | - |
| Sma3 | Pleckstrin homology-like domain | IPR011993 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G13300.1 | SFC, VAN3, AGD3 ARF GTPase-activating protein chr5:4255923-4262018 REVERSE LENGTH=827 | 1.0e-21 | 87% |
| RefSeq | Arabidopsis thaliana | NP_196834.3 | ADP-ribosylation factor GTPase-activating protein AGD3 [Arabidopsis thaliana] | 2.0e-21 | 87% |
| RefSeq | Populus trichocarpa | XP_002299350.1 | predicted protein [Populus trichocarpa] | 5.0e-23 | 93% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q5W7F2
Fln msg: Distance to subject end: 574 aas, your sequence is shorter than subject: 47 - 827
Fln protein:
E
Protein Length:
48
Fln nts:
T
Fln Alignment:
GG46A6U02FJU7D___ELLHQMEPYIHQVLTYAQQSRERTNYEQAALAERMQEFKRQIDRESR
Q5W7F2_______________ELLHQMEPYINQVLTYAQQSRERSNYEQAALNEKMQEYKRQVDRESR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
