|
||||||
|
UniGene Name: sp_v3.0_unigene72471
Length: 245 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72471
C |
|
Ace file of the UniGene sp_v3.0_unigene72471
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Flavine-containing monoxygenase n=1 Tax=Populus trichocarpa RepID=B9H9Q8_POPTR | - | - | 1.0e-24 | 76% |
| FL-Next | sp=Flavin-containing monooxygenase YUCCA3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 77% |
| Sma3 | Flavine-containing monoxygenase | - | - | 3.072e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavin-containing monooxygenase. | EC:1.14.13.8 | - | 4.38e-21 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 4.38e-21 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 4.38e-21 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g13260; AT4g28720; AT4g32540; At1g04180; At1g04610; At2g33230; At4g13260; At4g28720; At4g32540; At5g11320; At5g25620; At5g43890; B1340F09.23; Bs3; Bs3-E; F16A16.170; F17N18.150; F20D22.5; F2I11_210; FML1; FML11; FML2; FML3; FML4; FML5; FML6; FML7; FML8 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | N,N-dimethylaniline monooxygenase activity | GO:0004499 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | auxin biosynthetic process | GO:0009851 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
| Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
| Sma3 | CUB | IPR000859 | - | 0.0 | - |
| Sma3 | Flavin monooxygenase FMO | IPR000960 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Monooxygenase, FAD-binding | IPR002938 | - | 0.0 | - |
| Sma3 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR003016 | - | 0.0 | - |
| Sma3 | Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal | IPR003953 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Beta-ketoacyl synthase, active site | IPR018201 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G04610.1 | YUC3 YUCCA 3 chr1:1279524-1281331 FORWARD LENGTH=437 | 6.0e-32 | 77% |
| RefSeq | Arabidopsis thaliana | NP_171955.1 | YUCCA family monooxygenase [Arabidopsis thaliana] | 8.0e-32 | 77% |
| RefSeq | Populus trichocarpa | XP_002309594.1 | flavine-containing monoxygenase [Populus trichocarpa] | 7.0e-32 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O23024
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 18 aas, your sequence is shorter than subject: 81 - 437
Fln protein:
S
Protein Length:
82
Fln nts:
C
Fln Alignment:
GG46A6U02GEW4I___TVILCTGYRSNVPNWLKDSDFFSDDGMPKTPFPDGWKGENGLYSVGFTRRGLLGASLDARRIAQDI
O23024_______________SVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
