|
||||||
|
UniGene Name: sp_v3.0_unigene71932
Length: 219 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71932
C |
|
Ace file of the UniGene sp_v3.0_unigene71932
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Molybdenum cofactor sulfurase n=2 Tax=Arabidopsis RepID=MOCOS_ARATH | - | - | 2.0e-18 | 69% |
| FL-Next | sp=Molybdenum cofactor sulfurase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 69% |
| Sma3 | Molybdenum cofactor sulfurase | - | - | 1.54e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:4.4.-.- | - | 1.54e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABA3; At1g16540; F19K19.13; FLACCA; GSVIVT00025690001; LOC_Os06g45860; LOS5; MCSU3; Os06g0670000; OsI_24059; OsJ_22313; P0686E06.35; PHYPADRAFT_118134; POPTRDRAFT_719124; RCOM_1575730; VITISV_010646; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | Mo-molybdopterin cofactor sulfurase activity | GO:0008265 | Molecular Function | 0.0 | - |
| Sma3 | selenocysteine lyase activity | GO:0009000 | Molecular Function | 0.0 | - |
| Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
| Sma3 | molybdenum ion binding | GO:0030151 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | Mo-molybdopterin cofactor biosynthetic process | GO:0006777 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | sugar mediated signaling pathway | GO:0010182 | Biological Process | 0.0 | - |
| Sma3 | molybdenum incorporation into molybdenum-molybdopterin complex | GO:0018315 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Molybdenum cofactor sulfurase, C-terminal | IPR005302 | - | 0.0 | - |
| Sma3 | MOSC, N-terminal beta barrel | IPR005303 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G16540.1 | SIR3, LOS5, ABA3, ATABA3, ACI2 molybdenum cofactor sulfurase (LOS5) (ABA3) chr1:5659465-5665201 FORWARD LENGTH=819 | 9.0e-24 | 69% |
| RefSeq | Arabidopsis thaliana | NP_564001.1 | Molybdenum cofactor sulfurase [Arabidopsis thaliana] | 1.0e-23 | 69% |
| RefSeq | Populus trichocarpa | XP_002310102.1 | predicted protein [Populus trichocarpa] | 2.0e-22 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C5X8
Fln msg: Distance to subject end: 31 aas, your sequence is shorter than subject: 72 - 819
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U02GRBIS___RPNLVISGAEPYEEDDWHSVTVGKEHFIVLGGCNRCQMINIDPQTGLQSK-NEPLATLASYRRIK
Q9C5X8_______________RPNLVISGGEPYGEDKWKTVKIGDNHFTSLGGCNRCQMINISNEAGLVKKSNEPLTTLASYRRVK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
