UniGene Name: sp_v3.0_unigene71628
Length: 212 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71628
C |
Ace file of the UniGene sp_v3.0_unigene71628 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Trehalose-6-phosphate synthase n=1 Tax=Ginkgo biloba RepID=Q5D6D9_GINBI | - | - | 6.0e-27 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | Trehalose-6-phosphate synthase, putative | - | - | 3.383e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha,alpha-trehalose-phosphate synthase (UDP-forming). | EC:2.4.1.15 | - | 1.11901e-40 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 1.11901e-40 | % | |
Sma3 | Trehalose-phosphatase. | EC:3.1.3.12 | - | 1.809e-18 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 1.809e-18 | % |
Source | Gene names |
---|---|
Sma3 | 40.t00052; At1g06410; At1g23870; At1g60140; At1g68020; At1g70290; At2g18700; At4g17770; B1130G10.15; CHLREDRAFT_131610; F17O7.18; FCAALL.9; GSVIVT00015722001; GSVIVT00016126001; GSVIVT00018785001; GSVIVT00028851001; GSVIVT00030610001; GSVIVT00035830001; L |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity | GO:0003825 | Molecular Function | 0.0 | - |
Sma3 | trehalose biosynthetic process | GO:0005992 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 20 | IPR001830 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Trehalose-phosphatase | IPR003337 | - | 0.0 | - |
Sma3 | HAD-superfamily hydrolase, subfamily IIB | IPR006379 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70290.1 | ATTPS8, TPS8, ATTPSC trehalose-6-phosphatase synthase S8 chr1:26471286-26474078 REVERSE LENGTH=856 | 1.0e-29 | 82% |
RefSeq | Arabidopsis thaliana | NP_177186.2 | putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 [Arabidopsis thaliana] | 2.0e-29 | 82% |
RefSeq | Populus trichocarpa | XP_002338257.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-31 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NZZ7
Fln msg: Distance to subject end: 112 aas, your sequence is shorter than subject: 60 - 173
Fln protein:
M
Protein Length:
61
Fln nts:
C
Fln Alignment:
GG46A6U02GTUO6___MKLYTETTDGSAIEAKESALVWHHQDADPDFGSCQSKELLDHLESVLANEPVEVKSGQHI
A9NZZ7_______________MKLYTETTDGSTIEAKESALVWHHQDADPDFGSCQAKELLDHLESVLANEPVVVKSGHHI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain