|
||||||
|
UniGene Name: sp_v3.0_unigene71579
Length: 151 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71579
C |
|
Ace file of the UniGene sp_v3.0_unigene71579
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cationic peroxidase 2 n=1 Tax=Arachis hypogaea RepID=PER2_ARAHY | - | - | 2.0e-10 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Peroxidase | - | - | 4.666e-06 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 1.783e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 1.783e-10 | % | |
| Sma3 | Methane metabolism | 00680 | 1.783e-10 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 1.783e-10 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.783e-10 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.783e-10 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.783e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g41480; GSVIVT00008529001; GSVIVT00016893001; GSVIVT00016895001; GSVIVT00016899001; P25; PER25; PNC2; POPTRDRAFT_560610; POPTRDRAFT_911056; RCOM_0223760; T26J13.7; VITISV_031863; cevi16; ep5C; poa1; poxN1; prxr7; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Haem oxygenase-like, multi-helical | IPR016084 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G41480.1 | Peroxidase superfamily protein chr2:17296986-17298729 REVERSE LENGTH=341 | 2.0e-12 | 73% |
| RefSeq | Arabidopsis thaliana | NP_181679.3 | putative peroxidase [Arabidopsis thaliana] | 3.0e-12 | 73% |
| RefSeq | Populus trichocarpa | XP_002308082.1 | predicted protein [Populus trichocarpa] | 9.0e-14 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NST7
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 49 - 329
Fln protein:
S
Protein Length:
50
Fln nts:
C
Fln Alignment:
GG46A6U02FFW40___SLRGLLGFRFDVAFAKAMQKMSNIGVKTGTQGEVRKVCSAFN
A9NST7_______________SVRGILGFRFDFDFTKAMIKMSNIGVKTGTDGEIRKVCSAFN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
