UniGene Name: sp_v3.0_unigene71354
Length: 202 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71354
C |
Ace file of the UniGene sp_v3.0_unigene71354 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative sinapyl alcohol dehydrogenase (Fragment) n=1 Tax=Ginkgo biloba RepID=E5F5P7_GINBI | - | - | 7.0e-20 | 76% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
Sma3 | Cinnamyl alcohol dehydrogenase | - | - | 7.899e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 9.001e-12 | - |
Source | Gene names |
---|---|
Sma3 | CAD; CAD1; CAD2; CADL10; CADL11; CADL2; CADL4; CADb; CADb-1; CADb-2; CHLREDRAFT_190510; GSVIVT00000463001; GSVIVT00002954001; GSVIVT00004641001; GSVIVT00011479001; GSVIVT00011482001; GSVIVT00011484001; GSVIVT00011638001; GSVIVT00011639001; GSVIVT000116400 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
Sma3 | cofactor binding | GO:0048037 | Molecular Function | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR017900 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G21890.1 | CAD3, ATCAD3 cinnamyl alcohol dehydrogenase homolog 3 chr2:9331089-9332646 FORWARD LENGTH=375 | 6.0e-16 | 54% |
RefSeq | Arabidopsis thaliana | NP_179780.1 | cinnamyl alcohol dehydrogenase 3 [Arabidopsis thaliana] | 8.0e-16 | 54% |
RefSeq | Populus trichocarpa | XP_002301953.1 | cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] | 1.0e-17 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PS97
Fln msg: Distance to subject end: 102 aas, your sequence is shorter than subject: 67 - 366
Fln protein:
V
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U02FN9VE___LAVKFGEAFGLQVTVISA*PSKEKGAREILGADHFIISKDEKQMQAAVESVDYIIDTVSANHAV
C0PS97_______________MAVKLGKAFGLRVTVISTSPKKEKEAREVLGADHFIISKDQKQMQDAAKSLDYIIDTVSADHPI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain