|
||||||
|
UniGene Name: sp_v3.0_unigene70931
Length: 240 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene70931
C |
|
Ace file of the UniGene sp_v3.0_unigene70931
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | gamma hydroxybutyrate dehydrogenase [Arabidopsis thaliana] | - | - | 4.0e-25 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | 3-hydroxyisobutyrate dehydrogenase, putative | - | - | 2.742e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.1.1.6- | - | 1.828e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | 6PGDH; AT3G25530; At1g17650; At3g25530; B1151A10.27; CHLREDRAFT_120516; GSVIVT00002146001; GSVIVT00005391001; GSVIVT00013336001; GSVIVT00034187001; LeSSR1; LeSSR2; MICPUCDRAFT_30929; MICPUN_87578; MtrDRAFT_AC148918g29v2; OJ1712_E04.5; OSTLU_45774; Os01g05 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | 3-hydroxybutyrate dehydrogenase activity | GO:0003858 | Molecular Function | 0.0 | - |
| Sma3 | phosphogluconate dehydrogenase (decarboxylating) activity | GO:0004616 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | 3-hydroxyisobutyrate dehydrogenase activity | GO:0008442 | Molecular Function | 0.0 | - |
| Sma3 | glyoxylate reductase (NADP) activity | GO:0030267 | Molecular Function | 0.0 | - |
| Sma3 | 4-hydroxybutyrate dehydrogenase activity | GO:0047577 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | pentose-phosphate shunt | GO:0006098 | Biological Process | 0.0 | - |
| Sma3 | valine metabolic process | GO:0006573 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 3-hydroxyisobutyrate dehydrogenase-related, conserved site | IPR002204 | - | 0.0 | - |
| Sma3 | 6-phosphogluconate dehydrogenase, NADP-binding | IPR006115 | - | 0.0 | - |
| Sma3 | IPR006183 | - | 0.0 | - | |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | 3-hydroxyacid dehydrogenase/reductase | IPR015815 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G25530.1 | GHBDH, ATGHBDH, GLYR1, GR1 glyoxylate reductase 1 chr3:9271949-9273514 REVERSE LENGTH=289 | 2.0e-32 | 78% |
| RefSeq | Arabidopsis thaliana | NP_001030765.1 | glyoxylate reductase 1 [Arabidopsis thaliana] | 2.0e-32 | 78% |
| RefSeq | Populus trichocarpa | XP_002320548.1 | predicted protein [Populus trichocarpa] | 2.0e-30 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NNG8
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 63 aas, your sequence is shorter than subject: 79 - 293
Fln protein:
S
Protein Length:
80
Fln nts:
C
Fln Alignment:
GG46A6U02I6A7A___SLILGEMGNGAKMKLVVNMIMGSMMNAFSEGLCLADKSGLSPQTLLDVLDLGAISNPMFKMKGPSMLQGSY
A9NNG8_______________AFFLGEVGNGAKMKLVVNMIMGSMITAFSEGLALADKSGLSQTTLLDVLELGAIANPMFKLKGPAMIQEKF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
