SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene70365

Length: 454 nt

UniGene Fasta

>sp_v3.0_unigene70365
CGTCGTGACCTTGGCTGTCACTCATCTTGAATTTGTAGACGGGGGTGATCTTTTCGACGAAATCGTGAGCGTCTGCTTGCCTGCCGTATTGCAAGTGTTTGCAGCTTTGCTGTCATGTGATTTTAAAACTTAATTTCCCTTTTCTATAAACAGTCGTGTAATGGCAAGCTGGAGGAAAGAAGAGCGAGAAGATACTTCCAGCAGCTTATCGACGCCGTAGGATATTGCCACAGCAAGGGTGTTTACCACAGAGATCTGAAGGTATAATATATCGTTGAAGCCTCGATATTTTTTAATCGATGCTTATGTCGTGAAATAAACTTTAGTTGTTGAAACGCATGAATTATGATCAGCCCGAAAATATTCTGCTCGAAGCAAGTGGAAATGTGAAGATATCTGACTTTGGCCTCAGCGCGGTGCCTCAGCAATTTAGGGAAGACGGGCTCCTGCATAC

Ace file of the UniGene sp_v3.0_unigene70365

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	CBL-interacting serine/threonine-protein kinase 23 n=1 Tax=Arabidopsis thaliana RepID=CIPKN_ARATH	-	-	2.0e-22	73%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	78%
Sma3	Ser/Thr protein kinase	-	-	5.911e-10	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific serine/threonine protein kinase.	EC:2.7.11.1	-	5.793e-26	-
Sma3	Calcium/calmodulin-dependent protein kinase.	EC:2.7.11.17	-	7.205e-06	-

Source	Gene names
Sma3	At1g01140; At1g30270; At2g26980; At2g30360; At4g24400; At5g10930; At5g21326; At5g45820; CIPK11; CIPK12; CIPK13; CIPK14; CIPK15; CIPK20; CIPK23; CIPK24; CIPK25; CIPK26; CIPK27; CIPK3; CIPK31; CIPK32; CIPK33; CIPK5; CIPK8; CIPK9; CK1; F12P21.6; F6F3.28; GSV

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	potassium channel activity	GO:0005267	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	manganese ion binding	GO:0030145	Molecular Function	-
Sma3	potassium ion binding	GO:0030955	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	response to nutrient	GO:0007584	Biological Process	-
Sma3	response to pH	GO:0009268	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to abiotic stimulus	GO:0009628	Biological Process	-
Sma3	response to cytokinin stimulus	GO:0009735	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	abscisic acid mediated signaling pathway	GO:0009738	Biological Process	-
Sma3	potassium ion import	GO:0010107	Biological Process	-
Sma3	stomatal movement	GO:0010118	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	NAF domain	IPR004041	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	NAF/FISL domain	IPR018451	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G30270.1	CIPK23, SnRK3.23, ATCIPK23, LKS1 CBL-interacting protein kinase 23 chr1:10655270-10658524 FORWARD LENGTH=482	1.0e-24	73%
RefSeq	Arabidopsis thaliana	NP_564353.1	CBL-interacting serine/threonine-protein kinase 23 [Arabidopsis thaliana]	1.0e-24	73%
RefSeq	Populus trichocarpa	XP_002331059.1	predicted protein [Populus trichocarpa]	5.0e-24	68%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NWP7

Fln msg: Separated hits, possible frame ERROR between 67 and 139, and possible frame ERROR between 261 and 351, Distance to subject end: 277 aas, your sequence is shorter than subject: 151 - 450

Fln protein: VVTLAVTHLEFVDGGDLFDEIxxxxxxxxxxxxxxxxxxxxxxxxxLFYKQSCNGKLEERRARRYFQQLIDAVGYCHSKGVYHRDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQPENILLEASGNVKISDFGLSAVPQQFREDGLLH

Protein Length: 152

Fln nts: CGTCGTGACCTTGGCTGTCACTCATCTTGAATTTGTAGACGGGGGTGATCTTTTCGACGAAATCGTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCCTTTTCTATAAACAGTCGTGTAATGGCAAGCTGGAGGAAAGAAGAGCGAGAAGATACTTCCAGCAGCTTATCGACGCCGTAGGATATTGCCACAGCAAGGGTGTTTACCACAGAGATCTGAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxATCAGCCCGAAAATATTCTGCTCGAAGCAAGTGGAAATGTGAAGATATCTGACTTTGGCCTCAGCGCGGTGCCTCAGCAATTTAGGGAAGACGGGCTCCTGCATAC

Fln Alignment:

GG46A6U02IDEYZ___LEFVDGGDLFDEIVxxxxxxxxxxxxxxxxxxxxxxxxLFYKQSCNGKLEERRARRYFQQLIDAVGYCHSKGVYHRDLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQPENILLEASGNVKISDFGLSAVPQQFREDGLLH
A9NWP7_______________LEFVTGGELFDKIVxxxxxxxxxxxxxxxxxxxxxxxxLFDKIVHQQRLSENESRKYFQQLIDAVDYCHSKGVYHRDLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPENLLLDSQGNLKISDFGLSALPQQLREDGLLH

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain