|
||||||
|
UniGene Name: sp_v3.0_unigene69722
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69722
C |
|
Ace file of the UniGene sp_v3.0_unigene69722
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cinnamoyl-CoA reductase [Acacia auriculiformis x Acacia mangium] gb|ADQ53455.1| cinnamoyl-CoA reductase [Acacia auriculiformis x Acacia mangium] | - | - | 8.0e-17 | 59% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Sma3 | Putative cinnamoyl-CoA reductase | - | - | 4.189e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrokaempferol 4-reductase. | EC:1.1.1.219 | - | 6.271e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 6.271e-06 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.271e-06 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.271e-06 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.271e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g33600; At5g58490; B1129H01.17; GSVIVT00024039001; GSVIVT00028610001; LOC_Os03g60380; OJ1754_E06.1; OSJNBa0094J08.6; Os01g0528800; Os03g0818200; OsI_02260; OsI_14080; OsJ_02064; OsJ_13122; POPTRDRAFT_722576; RCOM_1094170; RCOM_1578400; SDM1_28t00008; V |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | 3-beta-hydroxy-delta5-steroid dehydrogenase activity | GO:0003854 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | steroid biosynthetic process | GO:0006694 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | 3-beta hydroxysteroid dehydrogenase/isomerase | IPR002225 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G58490.1 | NAD(P)-binding Rossmann-fold superfamily protein chr5:23643068-23644455 FORWARD LENGTH=324 | 9.0e-22 | 60% |
| RefSeq | Arabidopsis thaliana | NP_200657.1 | Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] | 1.0e-21 | 60% |
| RefSeq | Populus trichocarpa | XP_002313227.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 63% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PS01
Fln msg: Distance to subject end: 208 aas, your sequence is shorter than subject: 79 - 323
Fln protein:
V
Protein Length:
80
Fln nts:
C
Fln Alignment:
GG46A6U01ATV67___GARERLRLFQVDLLNYESLAAAINGCRGVFHLACPNIIDKVDDPKTALVDPAVEGTLNVLKASTAA
C0PS01_______________GAKERLKLFKMDLMDYQSIQDAIDGCSGVFHLAMPNTIDAVEDPQKQLLDPGIKGTINVLEAAHKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
