|
||||||
|
UniGene Name: sp_v3.0_unigene69720
Length: 188 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69720
C |
|
Ace file of the UniGene sp_v3.0_unigene69720
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Leucine-rich repeat/extensin n=2 Tax=Nicotiana RepID=A3KD20_NICPL | - | - | 7.0e-10 | 56% |
| FL-Next | sp=Leucine-rich repeat extensin-like protein 7; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
| Sma3 | Extensin-like protein | - | - | 3.675e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g13340; At1g12040; At3g24480; At4g13340; At5g25550; F12F1.9; GSVIVT00016771001; GSVIVT00020038001; GSVIVT00033788001; LRX1; NpLRX1; NtLRX1; OJ1174_D05.4; OSJNBa0026E05.15; Os01g0180000; Os02g0138000; Os05g0180300; Os06g0704500; OsI_00647; OsI_05777; Os |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | cell morphogenesis involved in differentiation | GO:0000904 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall organization | GO:0009664 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | trichoblast differentiation | GO:0010054 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S3Ae | IPR001593 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Repetitive proline-rich cell wall protein repeat | IPR003883 | - | 0.0 | - |
| Sma3 | Extensin repeat | IPR006706 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Ribosomal protein S3Ae, conserved site | IPR018281 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G25550.1 | Leucine-rich repeat (LRR) family protein chr5:8894179-8895480 FORWARD LENGTH=433 | 5.0e-12 | 61% |
| RefSeq | Arabidopsis thaliana | NP_197937.1 | leucine-rich repeat extensin-like protein 7 [Arabidopsis thaliana] | 6.0e-12 | 61% |
| RefSeq | Populus trichocarpa | XP_002308141.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-13 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q4PSE6
Fln msg: Distance to subject end: 174 aas, your sequence is shorter than subject: 62 - 433
Fln protein:
V
Protein Length:
63
Fln nts:
C
Fln Alignment:
GG46A6U01CVCJC___QFRLEIPPNLGNSPVSVIVFANNNLRGCVPPSLGKMNATXXXXXXXXXXXSACLP
Q4PSE6_______________RFRSKIPVNMGNSPVSVLVLASNRFEGCIPPSFGKMGKTLNEIILMDNGLQSCIP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
