|
||||||
|
UniGene Name: sp_v3.0_unigene69696
Length: 222 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69696
C |
|
Ace file of the UniGene sp_v3.0_unigene69696
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cationic amino acid transporter, putative n=1 Tax=Ricinus communis RepID=B9SKU5_RICCO | - | - | 2.0e-18 | 75% |
| FL-Next | sp=Cationic amino acid transporter 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 73% |
| Sma3 | Cationic amino acid transporter, putative | - | - | 5.197e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g21120; At2g34960; At4g21120; B1394A07.6; F7J7.60; GSVIVT00028403001; GSVIVT00028405001; GSVIVT00030103001; LOC_Os03g43970; LOC_Os12g41890; Os01g0209800; Os03g0641200; OsI_00855; OsI_12773; OsI_39096; OsJ_00840; OsJ_11862; OsJ_36854; P0031E09.3; P0466B |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | L-glutamate transmembrane transporter activity | GO:0005313 | Molecular Function | 0.0 | - |
| Sma3 | amino acid transmembrane transporter activity | GO:0015171 | Molecular Function | 0.0 | - |
| Sma3 | arginine transmembrane transporter activity | GO:0015181 | Molecular Function | 0.0 | - |
| Sma3 | L-lysine transmembrane transporter activity | GO:0015189 | Molecular Function | 0.0 | - |
| Sma3 | cationic amino acid transmembrane transporter activity | GO:0015326 | Molecular Function | 0.0 | - |
| Sma3 | amino acid transport | GO:0006865 | Biological Process | 0.0 | - |
| Sma3 | L-arginine import | GO:0043091 | Biological Process | 0.0 | - |
| Sma3 | L-glutamate import | GO:0051938 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Opsin | IPR001760 | - | 0.0 | - |
| Sma3 | Amino acid/polyamine transporter I | IPR002293 | - | 0.0 | - |
| Sma3 | Cationic amino acid transport permease | IPR004755 | - | 0.0 | - |
| Sma3 | Amino acid permease domain | IPR004841 | - | 0.0 | - |
| Sma3 | Cationic amino acid transporter | IPR015606 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G21120.1 | AAT1, CAT1 amino acid transporter 1 chr4:11270318-11273775 FORWARD LENGTH=594 | 8.0e-23 | 73% |
| RefSeq | Arabidopsis thaliana | NP_193844.2 | amino acid transporter 1 [Arabidopsis thaliana] | 1.0e-22 | 73% |
| RefSeq | Populus trichocarpa | XP_002318265.1 | cationic amino acid transporter [Populus trichocarpa] | 1.0e-21 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q84MA5
Fln msg: Distance to subject end: 38 aas, your sequence is shorter than subject: 74 - 594
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
GG46A6U01CUSZZ___VPLARTPKLWGVPLVPWIPVLSIAINIFLLGSIDKDSFIRFAVWTAIILLYYI
Q84MA5_______________VPQARAPKIWGVPLVPWLPSASIAINIFLLGSIDTKSFVRFAIWTGILLIYYV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
